(data stored in ACNUC7421 zone)

EMBL: AP010803.DNAE

AP010803.DNAE        Location/Qualifiers
FT   CDS_pept        426890..430162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="SJA_C1-04130"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95247"
FT                   /db_xref="GOA:D4YY15"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY15"
FT                   /protein_id="BAI95247.1"
FT                   /translation="MTAPRYAELQVTSHFSFLRGASSCEELFSQAALAGIEALAVVDRN
FT                   SLAGIVRAHQAAKTTGVRLIVGCRLDLVDGASMLVYPTDRSAYSRLCRLLSLGKQRAGK
FT                   AKCHLEWPDLMAYGEGLIVVLVPDQADAECALRLRRLRDAFGDRAYLALTLRRRPNDQL
FT                   RIHELSNLATQMRVPTVVTNDVLFHEPARRVLQDVVTCIRHNVTIDALGDRRERHADRY
FT                   IKPPEEMHRLFARYPEALARTLQIADRCRFNLDELAYQYPEERDDPALTPQETLAKLTW
FT                   EGAAQRYPEGVPDSVIAALRHELRLIEKLGYAPYFLTVNAIVRFARSKDILCQGRGSAA
FT                   NSAVCYVLGITSIDPGRNDLLFERFVSEERREPPDIDVDFEHERREIVMQWVFDTYGRD
FT                   HAALCSTVIRYRTKGALRDVGKALGLPEDLIGTLSSQVWAWSEEGVEQRHVEALNLNLA
FT                   DRRLRLTLDLARQLMGAPRHLSQHPGGFVLTHDRLDDLVPIEPAAMKDRQVIEWDKDDI
FT                   DALKFMKVDVLALGMLTCMKKGLDLLAEHKGVNLDLASIPAEDPRTYAMIRKADTLGTF
FT                   QIESRAQMSMLPRLKPRTYYDLVVQVAIVRPGPIQGDMVHPYLRRREGLEPVHYPKPEL
FT                   EKVLGKTLGVPLFQEQAMRVAIECAGFTPGEADMLRKSMATFKFTGGVSHFRDKLIAGM
FT                   VANGYEQAFAEQTFKQLEGFGSYGFPESHAASFALIAYASAWLKCWHPDVFCAALLNSQ
FT                   PMGFYAPAQIVRDAIEHGVDVRPVCANASRWDCTLEPTSDESRYAVRLGLRMVKGLANT
FT                   HGAAIVSARADQPYTSIDDLWRRAGAPSAALVQLAEADAFRPALGLARREALWAIKALR
FT                   DEPLPLFAAASAREAGAIPEIDEPAVALRPMTAGGEVVEDYGHVGLTLRTHPLSFLRED
FT                   LQRRRIVTCAEAMAARDGRWVEAAGIVLVRQRPGSAKGVMFITLEDETGIANLVVWTKV
FT                   FEANRRAILSASMIAVRGRVQREGEVVHLVAQRITDLSGELASVGDRDMAFPLSHGRGD
FT                   QVRHGGSGPDPRELPPKGLRTRDIYIPDLHIDTIKVKTRDFR"
     atgaccgcgc cccgctacgc cgagcttcag gtcacctccc atttcagctt cctgcggggc        60
     gcgtcgtcct gcgaggagct gttctcccag gccgcgctgg ccggcatcga agcgctcgcg       120
     gtcgtggatc ggaactcgct ggccgggatc gtccgcgccc atcaggccgc gaagacgacg       180
     ggcgttcgcc tcatcgtcgg ctgccgcctc gaccttgtcg atggcgcctc aatgctcgtc       240
     taccccaccg accggtcggc ctattcgcgc ctgtgccggt tgctgtcgct cggcaaacag       300
     cgcgctggca aggccaagtg ccatctcgaa tggccggatc tcatggccta tggcgagggt       360
     ctcatcgtcg tcctcgtccc cgaccaggcc gatgcagaat gtgcgttgcg cctgcgccgc       420
     ctgcgcgacg ccttcggcga ccgcgcctat ctggcgttga cgctgcgccg ccggccgaac       480
     gaccagctca ggatccacga gctgtcaaac ctcgccacgc agatgcgcgt gccgaccgtg       540
     gtgacgaacg atgtgctctt ccacgagccc gcgcgccgcg tcctgcagga cgtcgtgacc       600
     tgcattcgcc acaacgtcac catcgacgcc ctgggcgacc gccgcgagcg ccatgccgat       660
     cggtacatca aaccgcccga ggagatgcat cggctgttcg cccgctatcc cgaagcgctc       720
     gccaggacct tgcagatcgc ggatcgttgc cgtttcaacc tcgatgaact ggcctaccaa       780
     tatccggagg agcgcgacga tccggcgctc acgccgcagg aaacgctggc aaaactgact       840
     tgggaaggag ccgctcaacg ctatcctgaa ggcgtgccgg acagcgtgat cgccgcgctg       900
     cggcacgagc tgcggctgat cgagaagctc ggctatgcgc catacttcct gacggtcaat       960
     gcgatcgttc gctttgcccg atcgaaggat atcctttgcc aggggcgcgg ctcggccgcc      1020
     aactcggcgg tctgctacgt cctgggcatc acctcgatcg acccgggacg taacgacctg      1080
     ctgttcgaac ggttcgtctc cgaggagcgg cgcgagccgc ccgacattga cgtcgatttc      1140
     gagcatgagc ggcgcgagat cgtcatgcag tgggtgttcg acacctacgg ccgcgaccat      1200
     gccgcgctct gctcgacggt catccgctat cgcaccaagg gcgcgctgcg cgacgtcggc      1260
     aaggcgctcg gcctccccga agatcttatc ggcacgctgt cctcgcaggt ctgggcctgg      1320
     tcggaggaag gcgtcgaaca gcgccacgtc gaggcgctga acctcaacct cgccgaccgc      1380
     aggctccgcc tgacgctcga tctcgcgcgc cagctcatgg gcgcgccgcg gcatctcagt      1440
     cagcaccccg gcggcttcgt cctgacccat gatcggctcg acgacctcgt gccgatcgag      1500
     ccggccgcaa tgaaggaccg gcaggtcatc gaatgggaca aggacgacat cgacgccctg      1560
     aagttcatga aagtcgacgt cctggcgctc gggatgctga cctgcatgaa gaaggggctg      1620
     gatctcctgg ccgagcacaa gggcgtcaat ctcgatctcg cctccatccc ggccgaggac      1680
     ccgcgcacct acgcgatgat ccgcaaggcg gacacgctcg gcacattcca gatcgagagc      1740
     cgggcgcaaa tgtcgatgct gccacgtcta aagccgcgca cctattacga tctcgtggtc      1800
     caggtcgcga tcgtcaggcc cggtccgatc cagggcgata tggtccatcc ctatcttcgc      1860
     cgccgggagg gccttgagcc cgtccactac ccgaagcccg agctggagaa agtgctcggc      1920
     aagacgctcg gcgtgccgct ctttcaggag caggcgatgc gggtcgcgat tgaatgcgcc      1980
     ggcttcacac cgggcgaagc cgacatgctg cgcaaatcga tggccacctt taagttcacc      2040
     ggcggcgtct cgcatttccg ggacaagctg atcgccggca tggtggccaa cggctacgag      2100
     caggcgttcg ccgagcagac cttcaaacag cttgagggct ttggcagtta cggatttccg      2160
     gaaagccacg cagcctcttt tgcactgatc gcctatgcca gcgcctggct caaatgctgg      2220
     catcccgatg tcttctgcgc ggccttgctc aattcgcagc ccatgggctt ctacgcaccc      2280
     gcccagatcg tcagggacgc gatcgagcac ggcgtcgatg ttcggccggt ctgcgccaac      2340
     gcttcgcgct gggactgcac cctcgagccc acctcggacg aaagccgcta cgccgtccgt      2400
     ctcggcctgc ggatggtcaa gggtctcgcg aacacccacg gcgccgcaat cgtctcggcg      2460
     cgcgccgatc agccctacac atcgatcgac gatctctggc gccgcgccgg cgcgccgtcc      2520
     gccgcgctcg tccagctcgc cgaggcggat gcgttccgtc cggcgctggg actggcgcgt      2580
     cgggaggccc tttgggcgat caaggccctc cgcgacgaac ccttgccgct gttcgcagcc      2640
     gcctccgccc gcgaggccgg cgccatcccc gagatcgacg agcccgcggt ggcgctgcgg      2700
     ccgatgacgg cgggcggcga agtcgtcgaa gactacggcc atgtcggact gacgctgcgc      2760
     acgcatccgc tcagcttctt gcgggaagat ctccagcgcc gccgcatcgt cacctgcgcc      2820
     gaggcgatgg ccgcgcgcga tggtcgatgg gtggaggcgg ccggcatcgt cctcgtccgg      2880
     caacgcccgg gcagcgccaa aggcgtcatg ttcatcacgc tcgaggacga gaccggcatc      2940
     gccaatctcg tggtgtggac gaaggtgttc gaggcgaaca ggcgcgccat tctgtcggcc      3000
     agcatgatcg ccgtgcgcgg ccgcgtgcag cgggagggcg aggtcgttca cctcgtcgcc      3060
     cagcgcatca ccgacctgtc gggcgagctg gccagcgtgg gcgatcgcga catggcgttt      3120
     ccgctgtccc acggccgagg ggatcaggtt cggcacggcg gctccggtcc cgatccccgc      3180
     gagctgcccc cgaaaggcct gcgcacccgg gatatctaca ttcccgatct ccacatcgat      3240
     acgatcaagg tgaagacgcg ggattttcga tga                                   3273
//

If you have problems or comments...

PBIL Back to PBIL home page