(data stored in ACNUC7421 zone)

EMBL: AP010803.DPS

AP010803.DPS         Location/Qualifiers
FT   CDS_pept        104735..105226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dps"
FT                   /locus_tag="SJA_C1-01050"
FT                   /product="starvation-inducible DNA-binding protein"
FT                   /note="DNA-binding ferritin-like protein (oxidative damage
FT                   protectant)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94939"
FT                   /db_xref="GOA:D4YX57"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX57"
FT                   /protein_id="BAI94939.1"
FT                   /translation="MTSPDLKTPTDLRSNATKSVAEALNGVLADSYALYFKTKNFHWHV
FT                   SGPHFRDYHLMFDEQATQILATTDLIAERVRKTGNTTLRSIGDISRHQSLVDNDADYVS
FT                   PGDMLNELREDNLKLVESLRAAKAAATEAGDNATEGIIDDWTDEAEERAWFLFEAGRNG
FT                   "
     atgacctccc ccgatctcaa gaccccgacg gacctgcgca gcaacgccac caagtctgtg        60
     gcggaggcgc tgaacggcgt gctcgcggac agctatgcgc tgtatttcaa gaccaagaat       120
     ttccactggc acgtgtccgg cccgcatttc cgcgactatc acctgatgtt cgacgagcag       180
     gcgacgcaga tcctggccac caccgacctg atcgcggagc gggtgcgcaa gaccggcaac       240
     accacgctgc gctccatcgg cgacatttcg cgccatcagt ccctggtcga caatgacgcc       300
     gattatgtca gccccggcga catgctgaac gaactgcgcg aggataatct gaagctggtg       360
     gaatccctgc gcgccgcgaa ggccgccgcc acggaggcgg gggacaacgc cacggagggc       420
     attatcgacg actggacgga cgaggccgag gaacgcgcct ggttcctgtt cgaggccggt       480
     cgcaacggtt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page