(data stored in ACNUC7421 zone)

EMBL: AP010803.FABI

AP010803.FABI        Location/Qualifiers
FT   CDS_pept        complement(182359..183153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="SJA_C1-01740"
FT                   /product="enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95008"
FT                   /db_xref="GOA:D4YXC6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXC6"
FT                   /protein_id="BAI95008.1"
FT                   /translation="MAGKRGLIMGLANDKSLAWGISKALHAQGAELAFSYQGEALAKRV
FT                   RPLAEELGSDFLIDCDVSDMEKLDAAFAEIEAKWGRLDFVVHAIGFSDKNELRGLYVDT
FT                   SLENFLLTMNISAYSFVAVAKRARALMPEGGSLLTLSYYGAEKVIPHYNVMGVAKAALE
FT                   TSVKYLAMDLGPENIRVNAISAGPIKTLAASGIGDFRYIMKWNELNSPLRRNVTIEDVG
FT                   GAGLYLLSDLASGVTGEVHHVDAGYNVIGMKAEDAPDIALDK"
     atggcgggaa aacgcggtct gatcatgggg ctggcgaacg acaagtcgct cgcctggggc        60
     atatcgaagg cgctgcatgc gcagggcgcg gaactcgcct tctcctatca gggcgaggcg       120
     ctggccaagc gggtgaggcc gctggcggag gagctggggt ccgatttcct gatcgactgc       180
     gacgtgtcgg acatggaaaa gctggacgcc gcctttgccg agatcgaggc gaaatggggc       240
     aggctggact tcgtggtcca cgccatcggc ttttccgaca agaatgagct gcgcggcctc       300
     tatgtcgaca ccagcctgga aaatttcctg ctgacgatga atatctccgc ctacagcttc       360
     gtcgccgtcg ccaagcgggc gcgagcgctg atgccggagg gcggcagcct gctgacgctc       420
     agctattatg gcgcggaaaa ggtgatcccc cattataacg tcatgggcgt ggccaaggcg       480
     gcgctggaaa ccagcgtcaa atatctggcg atggacctgg gtccggaaaa tatccgcgtc       540
     aacgccatct ccgccgggcc gatcaagacg ctggcggcca gcggcatcgg cgatttccgc       600
     tacatcatga agtggaacga actgaacagc ccgctccgcc gcaacgtgac gatagaggat       660
     gtgggcggcg ccggcctcta tctcctctcc gacctggcgt cgggcgtgac cggcgaagtc       720
     catcatgtcg acgcgggcta caatgtcatc ggcatgaagg ccgaagacgc gccggacatc       780
     gcattggaca agtaa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page