(data stored in ACNUC7421 zone)

EMBL: AP010803.FADB

AP010803.FADB        Location/Qualifiers
FT   CDS_pept        153842..154756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="SJA_C1-01480"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94982"
FT                   /db_xref="GOA:D4YXA0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXA0"
FT                   /protein_id="BAI94982.1"
FT                   /translation="MAIDLRGRVAIVTGAGGGLGREHALLLAKRGARVLVNDLGGASDG
FT                   RSAAAEAVAEEIRRNGGEAISNGADVTDVDQVAAMVEQAKAAWGRIDILVNNAGILRDR
FT                   TFVKQSLDDFRLVIEVHLMGSVNCTKAVWGEMIEQGYGRIVMTTSSSGLYGNFGQSQYG
FT                   AAKMGLVGLMKTLSLEGRRNDVRVNCLAPTAATGMTEGILDEQALAALDPALVAPGMLA
FT                   LVCDDAPNGMILCAGAGSFECAHITLTQGLYVGADAHAPERILAGIDRIRERAGEMVPV
FT                   AGMEQSNHELSRVPALQSAAADG"
     atggcaattg atcttcgagg ccgcgttgcg atcgtcaccg gcgccggtgg cggactgggc        60
     agggaacatg cgttgctgtt ggcaaagcgt ggcgcccggg tcttggtcaa cgacttgggc       120
     ggcgccagcg acgggcggtc cgccgcggcc gaagcagtgg cggaggagat tcgccgcaac       180
     ggtggcgagg caatctcgaa cggtgccgat gtcacggacg tcgaccaggt ggccgcgatg       240
     gtcgagcagg ccaaggcggc gtggggccgg atcgatatct tggtgaacaa tgcgggaatt       300
     ttgcgcgacc gaaccttcgt caagcagagt ttggacgatt ttcgccttgt catcgaagtg       360
     catctcatgg gctcggtcaa ttgcaccaag gctgtctggg gtgaaatgat cgagcagggc       420
     tatggccgta tcgtgatgac gacctcttcg tccgggctct acggcaattt cggtcaatcc       480
     caatatggcg cggccaagat ggggcttgta ggattgatga agacgctatc cctggaaggg       540
     cgcaggaacg atgtccgcgt caactgcctg gcgcccacgg ccgcgaccgg catgacagag       600
     ggaattcttg acgaacaggc gctcgctgca ttggacccgg ctctcgtcgc ccccggaatg       660
     cttgccctgg tatgcgacga tgcgcctaac ggcatgatcc tgtgcgcagg cgccggcagc       720
     ttcgagtgcg cgcatattac gcttacccag ggcctttacg tgggtgccga cgcccacgcg       780
     cccgaacgga tactcgccgg catcgatcgc atccgcgagc gcgcgggcga aatggtgccg       840
     gtcgcgggta tggagcaatc gaaccatgaa ctgtctcggg tgcccgccct ccaatcggcc       900
     gccgccgatg gttag                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page