(data stored in ACNUC7421 zone)

EMBL: AP010803.FADH

AP010803.FADH        Location/Qualifiers
FT   CDS_pept        complement(311348..312430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadH"
FT                   /locus_tag="SJA_C1-02950"
FT                   /product="2,4-dienoyl-CoA reductase (NADPH2)"
FT                   /EC_number="1.3.1.34"
FT                   /note="NADH:flavin oxidoreductase, Old Yellow Enzyme
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02950"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95129"
FT                   /db_xref="GOA:D4YXP7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXP7"
FT                   /protein_id="BAI95129.1"
FT                   /translation="MANLFEPVQLGAIHAPNRVLMAPLTRARATRDHVPTPIMADYYRQ
FT                   RASAGLIISEGIGVSRQGLGWPYAAGLWSAEQVEGWKLVTAAVHEAGGRIFAQLWHMGR
FT                   LVHSSMTGEQPISSSPVTAPGHAHSYDGNKPYEQPRALGIEEIPALVQTYVTAARNAIE
FT                   AGFDGVQIHGANGYLIDEFLRDGVNRREDAYGGPPENRVRLLREITQAVADAIGADRTA
FT                   VRLSLNGDSQGTDDSDPASLSLAVAQALDPIGLAFLELRELRTDGTRGASDVPRQSPLI
FT                   RQHYRGPLVLNSDYDAARAQADLDSGLAQAISFGRPFISNPDLPERLSTGAPLSPLRQE
FT                   TLYTQGAEGYVDYPALEKVA"
     atggccaatc tgttcgagcc ggtgcagcta ggggcgatcc atgccccaaa tcgcgtgctg        60
     atggcgccgc tcacccgcgc ccgcgccacc cgcgaccatg tgccgacgcc gatcatggcg       120
     gactattatc gccagcgcgc ttcggcgggc ctcatcatca gcgagggcat cggcgtgtcg       180
     cggcagggcc tgggctggcc ctatgcggcg ggcctgtggt ccgccgagca ggtcgaaggt       240
     tggaagctgg tgacggcggc ggtgcatgaa gcaggcggac ggatcttcgc ccagctttgg       300
     cacatgggac ggctggtgca cagcagcatg accggcgaac agccaatatc ctccagccct       360
     gtcaccgcgc ccggccatgc gcacagctat gacggcaaca aaccctatga gcagccgcgg       420
     gcgctgggca tcgaggagat tccggccctt gtccaaacct atgtgaccgc cgcccgcaat       480
     gccatcgagg cggggttcga cggcgtgcag atccacggcg ccaatggcta tctgatcgac       540
     gagttcctgc gcgacggcgt caacaggcgc gaggacgcct atggcggtcc gccggagaac       600
     cgcgtccgcc tgttgcggga gatcacgcag gccgtcgccg acgcgatcgg cgcggaccgc       660
     acggccgtcc gcctgtcgct gaacggcgat tcgcagggca ccgacgacag cgatcccgcc       720
     agcctgtcgc ttgcggtggc gcaagcgctg gacccgatcg gcctcgcctt cctggagctg       780
     cgcgaattgc ggacagacgg cacgcgcggc gccagcgacg tgccgcgcca atcgccgctt       840
     atccgccagc attatcgcgg gccgctggtc ctcaacagcg actatgacgc ggcgcgcgcc       900
     caggccgatc tggacagcgg gctggcgcag gcgatcagct tcggccgacc cttcatttcc       960
     aatcccgacc tgccggaacg gctgtcgacc ggcgcgccgc tcagtcccct gcggcaggag      1020
     acgctctata cgcagggcgc ggaaggctat gtcgattatc cggcgctgga aaaggttgcc      1080
     tga                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page