(data stored in ACNUC7421 zone)

EMBL: AP010803.FEOA

AP010803.FEOA        Location/Qualifiers
FT   CDS_pept        313349..313624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoA"
FT                   /locus_tag="SJA_C1-02970"
FT                   /product="Fe2+ transport system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02970"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95131"
FT                   /db_xref="GOA:D4YXP9"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXP9"
FT                   /protein_id="BAI95131.1"
FT                   /translation="MTSALPLRLTDLPLRQPAYVDLIDWNALSASDGQRLREFGLCEGA
FT                   SVEALHHGGLLGRGPIACKVGRMTIAMRRSHAAAITVRTGPSDGDL"
     atgacgagtg ccttaccctt gcgcctgacc gacctgccgt tgcgccaacc cgcttatgtg        60
     gacctgatcg actggaacgc gctgtccgcg tccgacggcc aaaggctgcg cgaattcggc       120
     ctgtgcgagg gcgcgagcgt cgaggccctg caccatggcg ggctgctggg gcgcggaccc       180
     atagcctgca aggtcggccg catgaccatc gccatgcgcc gcagccatgc cgccgccatc       240
     accgtccgca ccggcccttc ggacggcgac ctgtga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page