(data stored in ACNUC7421 zone)

EMBL: AP010803.FEOB

AP010803.FEOB        Location/Qualifiers
FT   CDS_pept        313621..315480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="SJA_C1-02980"
FT                   /product="Fe2+ transport system protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95132"
FT                   /db_xref="GOA:D4YXQ0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXQ0"
FT                   /protein_id="BAI95132.1"
FT                   /translation="MTNLPLIALVGNPNAGKSALFNALTGARQKLGNYPGVTVERKAGR
FT                   LSLSDGRPIELVDLPGTYSLSPTSPDEQVTRDVILGRQAGERLPDALVVVVDASNLDNH
FT                   LRFALELIALGLPTVVALNMVDLATRDGLELDAHILSRELGVPVISTVAVRKRGLDHLR
FT                   GELETMLDGSAGKARAPGEQSDFEGLRREARRIARAAVVRETPSRRLTAAVDRAALHPV
FT                   AGLVLLLALLFIMFQAVYAWSEAPIAMIEGFVASAGDAVTAALPDGLLRSFLVDGVLNG
FT                   VGSVIVFLPQILILFFFILMLEATGYMVRAAFLMDGLMARVGLSGRAFIPLLSSFACAV
FT                   PGIMATRTIADPKDRLTTILIAPLMTCSARLPVYAVIIGAFIPARTVALGIGLQGLVLF
FT                   CLYISGIVGAMLAALVLRRTVTRGASGGFLMEMPKYQWPRPQDIVLGLWQRAVIFLKRA
FT                   GTIIFTSTVILWVLLSFPKAPEDGAVSQVNYSIAGRVANGLNLVLAPIGFNRDISLALI
FT                   PAMAAREVAVSALATVYSLDADEDEARLERSLGDRLKDNWPLPTALAFLAWFVFAPQCI
FT                   STIAVTRRETNGWKWPLFMIGYLFALAYAAAGLTYWTATAAGL"
     gtgacgaacc tgccgctgat cgcgctggtc ggcaatccca atgccggcaa gagcgccctg        60
     ttcaacgcat tgaccggggc gcggcagaag ctgggcaatt atcccggcgt caccgtggag       120
     cgcaaggcgg gccgcctttc cctgtcggac ggccggccga tcgagctggt tgacctgccc       180
     ggcacctaca gcctcagccc caccagcccc gacgagcagg tgacgcgcga cgtcatattg       240
     ggcaggcagg cgggcgagcg cctgcccgac gcgctggtcg tggtggtcga cgcctccaac       300
     ctcgacaatc atctccgctt cgcgctggaa ctgatcgcgc tgggcctgcc gaccgtcgtc       360
     gcgctcaaca tggtcgacct cgccacccgc gacgggctgg aactggacgc ccatatcctg       420
     tcccgcgaac tgggcgtgcc ggtgatctcc accgtggcgg tgcgcaagcg cggcctggat       480
     catctgcgcg gcgagctgga aaccatgctg gacggcagcg cgggcaaggc ccgcgctcca       540
     ggcgaacaga gcgatttcga aggattgcgc cgggaggcgc gccgcatcgc ccgcgccgcc       600
     gtcgtgcgcg aaaccccgtc ccgccgcctg accgcggctg tcgaccgggc ggcgctgcat       660
     cccgtcgcgg ggctggtcct gctgctcgcg cttctcttca tcatgttcca ggcggtctat       720
     gcctggtccg aagcgccgat cgccatgatc gaaggctttg tcgccagcgc cggcgacgcc       780
     gtgacggccg cgctgcccga tggactgctg cgatccttcc tggtcgacgg agtgctgaac       840
     ggcgtcggct cggtcatcgt gttcctgccg cagatcctga tcctcttctt cttcatcctg       900
     atgctggagg cgaccggcta tatggtccgc gccgccttcc tgatggacgg gctgatggcg       960
     cgggtgggcc tgtcggggcg ggccttcatc ccgctgctgt cctccttcgc ctgcgcggtg      1020
     ccggggatca tggcgacgcg caccatcgcg gacccgaagg accggctgac caccatattg      1080
     atcgcgccgc tgatgacctg ctccgcccgg ctgccggtct atgccgtgat catcggcgcc      1140
     ttcatcccgg cgcgcacggt cgcgctcggc atcggccttc aggggctggt cctcttttgc      1200
     ctctatatat ccggcatcgt cggcgcgatg ctggcggcgc tggtcctgcg ccgcaccgtc      1260
     accaggggcg cgagcggcgg tttcctgatg gagatgccga aatatcagtg gccgcgcccg      1320
     caggacatag tgctgggcct gtggcagcgg gcggtgatct tcctcaagcg cgcgggcacg      1380
     atcatcttca cctcgaccgt gatcctctgg gtgctgctca gcttccccaa ggcgccggag      1440
     gatggcgcgg tcagccaggt caactattcc atcgcgggcc gcgtcgccaa cggcctcaac      1500
     ctggtgctgg ccccgatcgg cttcaaccgc gacatctcgc tcgcgctgat ccccgccatg      1560
     gcggcgcgcg aagtggcggt atccgcgctc gccaccgtct attcgctcga cgccgacgag      1620
     gatgaagcga ggctggagcg cagcctgggc gaccggctga aggacaattg gccgctgccc      1680
     acggcgctcg ccttcctcgc ctggttcgtc ttcgcgccgc agtgcatctc caccatcgcg      1740
     gtgacgcggc gcgagaccaa cgggtggaag tggccgctgt tcatgatcgg ctatctgttc      1800
     gcgctggcct atgccgcggc cggccttacc tactggaccg ccaccgcagc ggggctataa      1860
//

If you have problems or comments...

PBIL Back to PBIL home page