(data stored in ACNUC7421 zone)

EMBL: AP010803.GIDA

AP010803.GIDA        Location/Qualifiers
FT   CDS_pept        complement(28105..29955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="SJA_C1-00290"
FT                   /product="NAD/FAD-utilizing enzyme apparently involved in
FT                   cell division"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94863"
FT                   /db_xref="GOA:D4YWY1"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWY1"
FT                   /protein_id="BAI94863.1"
FT                   /translation="MRTSYDVIVVGGGHAGCEAAGAAARKGAAVTLLTFERATVGAMSC
FT                   NPAIGGLGKGHLVREVDALDGLIARAADAAAIHYRMLNSSKGAAVQGPRVQADRKRYRA
FT                   EIHRLLDAQSGLEIVEGEAVGLLLAEGAVAGLSLADGRRLHAPSVVLATGTFLGGKLFR
FT                   GEETLTGGRISERAATALGVQLRALDLPMGRLKTGTPPRIDGRTIDWAALEAQPSDAEG
FT                   WTMSALSPGRPLPQLSCAITRTNDRTHAIIREGLGRSPLFSGAIEGRGPRYCPSIEDKV
FT                   IRFGDRDGHQIFLEPEGLDDHLVYPNGISTSLPADVQLAMVRSMAGLEKADIRVPGYAV
FT                   EYDHIDPRALDATLEVQAIPGLFCAGQINGTTGYEEAAAQGLLAGINAAARARGEGPLI
FT                   LDRASSYIGVMIDDLVLQGVTEPYRMLTARAEYRLRLRADNAGTRLAEIGFEHGVLGEE
FT                   RAAYYARRHDERAAVEEELSRTFSATEMARSGAPVRQDGARRSLFEWARFPEVGRSLLC
FT                   ELAPTLSRISHDLREELLEDAHYAPYLERQEAEIAEMRRNERVVIPAGFDFAAIGGLST
FT                   EMVERLTLARPDTLAAAGRIRGITPAALAALLVHIRRRAA"
     atgcggacaa gctatgacgt gatcgtggtc ggcggcggcc atgcaggctg cgaagcggct        60
     ggcgcagcgg cgcgcaaggg cgcggcggtc acgctgttga ccttcgaaag ggcgacggtg       120
     ggcgccatgt cctgcaatcc ggccattggc gggttgggca agggccatct ggtgcgcgaa       180
     gtggacgcgc tggacggcct gatcgcccgc gccgccgacg ccgccgccat ccattatcgc       240
     atgctgaaca gcagcaaggg cgcggcggtc caggggccgc gcgtgcaggc ggatcgcaag       300
     cgctatcgcg ccgagatcca ccgcctgctg gatgcccaat ccggtcttga aattgtcgag       360
     ggagaagccg tcgggctgct gctggcggaa ggggccgtcg ctggcctcag cctggctgat       420
     ggccgcaggc ttcatgcgcc ctcggtggtg ctggcgaccg gcacgttcct gggcggcaag       480
     ctgttccgcg gcgaggagac gctgacgggc ggccgcatca gcgagagagc cgcgaccgcg       540
     ctcggtgttc agcttcgtgc cctcgacctg cccatgggca ggctcaagac ggggactccg       600
     cccaggatcg atggccgcac catcgactgg gccgcactgg aggcgcaacc ttcggacgcg       660
     gaaggctgga ccatgtcagc cctgtcgccc ggtcgcccat tgccgcaact cagttgcgcc       720
     atcacccgca ccaatgaccg gacccatgcc atcattcggg aagggctggg gcgttcgccc       780
     ttgttcagcg gagccattga gggccggggg ccgcgctatt gcccctccat agaggataag       840
     gtgatccgct tcggggatcg ggacggacat cagatattcc tggaacccga agggttggac       900
     gaccatctgg tctatcccaa cggcatcagc acttcgctgc cggccgatgt ccaactggcc       960
     atggtccgat ccatggccgg gctggaaaag gccgacattc gggtgccggg ctatgccgtg      1020
     gaatatgacc atatcgatcc gcgagcgctg gacgcgaccc tggaggttca ggccatcccc      1080
     ggccttttct gcgccgggca gatcaacggc accacaggct atgaggaagc ggcggcgcag      1140
     ggcctgctgg ccgggatcaa cgccgccgcc agggcgaggg gggaagggcc gctcatcctg      1200
     gatcgggcca gcagctatat cggcgtgatg atcgacgacc tggtcctgca gggcgtgacc      1260
     gagccctatc gcatgctgac ggcgcgggcc gaatatcggc tgaggctgcg ggcggacaat      1320
     gccggcactc gattggcgga aatcggcttc gagcatggcg ttctgggcga ggaacgcgcc      1380
     gcttattacg ccaggcgcca tgacgagcgg gcagcggtcg aggaggaatt gagccgcacc      1440
     ttctccgcca cggaaatggc caggtcgggc gcgccggtcc ggcaggacgg cgcgcgccgc      1500
     tcgctgttcg aatgggcgcg ttttccggaa gtcgggcgtt cgctgctatg cgaacttgcg      1560
     cccacattgt cccgcatatc gcacgacctg cgcgaggaac tgctggagga tgcgcattac      1620
     gcgccctatc tggaacggca ggaggcggag atcgcggaaa tgcgccgcaa tgagcgcgtc      1680
     gtcattccag cgggtttcga tttcgccgcc attggggggc tgtcgaccga aatggtcgag      1740
     cggctcactc tggcgcgtcc cgatacgctt gctgcagcgg gtcgcattcg cggcataacg      1800
     ccggcggcgc tggccgccct tctcgtccat ataaggcggc gcgccgcgtg a               1851
//

If you have problems or comments...

PBIL Back to PBIL home page