(data stored in ACNUC7421 zone)

EMBL: AP010803.GLNB

AP010803.GLNB        Location/Qualifiers
FT   CDS_pept        complement(199329..199667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnB"
FT                   /locus_tag="SJA_C1-01910"
FT                   /product="nitrogen regulatory protein P-II 1"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01910"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95025"
FT                   /db_xref="GOA:D4YXE3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXE3"
FT                   /protein_id="BAI95025.1"
FT                   /translation="MKLVMAIIKPFKLDDVREALSSLGIAGMTVSEVKGFGRQKGQTEI
FT                   YRGAEYSTNMVPKIKIEVVCDDDLAPRVIEAVQAAANSGAIGDGKIFVLDVEQAVRIRT
FT                   GETGETAL"
     atgaaacttg tcatggctat catcaagccg ttcaagcttg acgatgtccg cgaggcactt        60
     tcctcgctcg gcatcgccgg catgacggtg agcgaagtga agggctttgg ccgccagaag       120
     gggcagaccg aaatctatcg cggcgctgaa tattcgacga acatggttcc gaagatcaag       180
     atcgaggtgg tctgcgacga cgatctcgcg ccccgcgtga tcgaggccgt tcaggcggcc       240
     gcgaattcgg gcgccatcgg cgatggcaag atcttcgttc tcgatgtcga gcaggcggtg       300
     cgcatccgta ccggcgaaac cggcgaaacc gcactgtaa                              339
//

If you have problems or comments...

PBIL Back to PBIL home page