(data stored in ACNUC7421 zone)

EMBL: AP010803.GYRB

AP010803.GYRB        Location/Qualifiers
FT   CDS_pept        complement(47877..50384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="SJA_C1-00470"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94881"
FT                   /db_xref="GOA:D4YWZ9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWZ9"
FT                   /protein_id="BAI94881.1"
FT                   /translation="MSEESQNNPNSNAYGADSIKVLKGLDAVRKRPGMYIGDTDDGSGL
FT                   HHMVFEVSDNAIDEALAGHCDRILITLNPDGSVSVEDNGRGIPTDIHKEEGVSAAEVIM
FT                   TQLHAGGKFENTSDDNAYKVSGGLHGVGVSVVNALSEYLDLNIWRDGKEHYMRFAYGDA
FT                   VAPLKVIGDAPEGKKGTKVTFLPSTEKVPGDGGTFKNHTEFDFEKLEHRYRELAFLNSG
FT                   VRLFLADARHEEKKEIELFYEGGIAAFVKWLDRNKQPLMPDPIAISGSRDDVTIDVALE
FT                   WNDSYYENVLCFTNNIPQRDGGTHLAAFRAALTRTLNNYADKSGLLKKEKVSLTGEDMR
FT                   EGLTAIVSVKLPDPKFSSQTKDKLVSSEVRQPLESLMADKMAEWLEENPQHGRMIVQKV
FT                   IDAAAAREAAKKARELTRRKGVMDIASLPGKLADCQERDPAKSELFLVEGDSAGGSAKQ
FT                   GRNRHNQAILPLKGKILNVERARFDRMLSSKEVGTLIQAMGTGIRDDFNLEKLRYHKIV
FT                   IMTDADVDGAHIRTLLLTFFYRQMPQIIEAGHLYIAQPPLYKATRGRSEVYLKNEAALE
FT                   NYLVDNGVESMALETTGGMRSGEDLRSLIEHGRRIRAVMRYVPRRYNPAIIEALAINGA
FT                   LDPELSHDAQAERLANTVRWMDAQDDEGRWSGRIAEEGGFHFERLWRGVTDHHMIEAGF
FT                   IGSAEARKLHAIAAEEADSYRTSSRLVTAKAAAAAEEAGEDELPVATKGSATVTRPSEL
FT                   LEAILTAGRKGLAIQRYKGLGEMNAEQLWETTLDPDNRSMLRVEVEQADVADEIFTRLM
FT                   GDVVEPRREFIQDNALNVANLDV"
     atgagcgagg aaagtcagaa caaccccaac agcaatgcct atggcgccga cagtatcaag        60
     gtcttgaaag ggctggatgc cgtgcgcaag cggcccggca tgtatatcgg cgacaccgac       120
     gacggctccg gcctgcacca tatggtgttc gaggtcagcg acaatgccat agacgaggcg       180
     ctggccggcc attgcgaccg catcctgatc acgctcaacc ccgacggatc ggtcagcgtc       240
     gaggataatg gccgcggcat ccccaccgac atccacaagg aagagggcgt gtcggcggcg       300
     gaggtcatca tgacccagct ccacgccggc ggcaagttcg agaacacgtc ggacgacaat       360
     gcctacaagg tgtcgggcgg cctgcatggc gtgggcgttt ccgtggtgaa cgcgctcagc       420
     gaatatctgg acctcaacat ctggcgggac ggcaaggagc attatatgcg ctttgcctat       480
     ggcgacgcgg tcgcgccgct caaggtcatc ggcgacgctc cggagggaaa gaaggggacg       540
     aaggtcactt tccttccctc gaccgagaaa gtgcccggcg acggcggcac cttcaagaac       600
     cataccgagt tcgatttcga gaagctggag catcgctatc gcgagctggc cttcctgaac       660
     agcggcgtgc ggctgttcct ggccgatgcg cggcatgagg agaagaagga gatcgagctg       720
     ttctacgagg gcgggatcgc ggccttcgtg aagtggctgg accgcaacaa gcagccgctg       780
     atgcccgatc ccatcgccat ttcgggcagc cgcgacgatg tcaccatcga cgtcgcgctg       840
     gaatggaacg acagctatta tgaaaatgtc ctctgtttca cgaacaacat tccgcagcgg       900
     gacgggggca cccatctggc ggcgttccgc gccgcgctga cgcggacgct caacaattat       960
     gcggacaagt cgggcctgct gaagaaggag aaggtctcgc tgaccggcga ggatatgcgc      1020
     gaggggctga ccgccatcgt gtcggtgaag ctgcccgatc ccaaattctc atcccagacc      1080
     aaggacaagc tggtctcgtc cgaagtgcgc cagccgctgg aaagcctgat ggccgacaag      1140
     atggccgaat ggctggagga aaacccccag catggccgca tgatcgtcca gaaggtgatc      1200
     gacgccgccg ccgcccgcga ggcggcgaag aaggcgcggg aactgacccg gcgcaagggg      1260
     gtgatggaca tcgcctccct gcccggcaag ctggccgact gtcaggaacg cgaccccgcc      1320
     aagtccgaac tcttcctggt tgagggcgat tcggcgggcg gctcggccaa gcaggggcgc      1380
     aaccggcaca atcaggcgat tctgccgctg aagggcaaga tcctgaacgt cgagcgcgcc      1440
     cgtttcgacc ggatgctgtc gtcaaaggag gtcggcacgc tcattcaggc gatgggcacc      1500
     ggcatccgcg acgatttcaa cctggaaaag ctgcgctacc acaagatcgt catcatgacc      1560
     gatgccgacg tcgacggcgc gcatatccgc acgctgctgc tgaccttctt ctaccgccag      1620
     atgccgcaga tcatcgaggc ggggcatctc tacatcgcgc agccgccgct ctacaaggcg      1680
     acgcggggcc ggtcggaggt ctatctgaag aatgaggcgg cactggaaaa ttacctggtc      1740
     gacaatggcg tcgaatccat ggcgctggaa acgaccggcg gcatgcggtc gggcgaagac      1800
     ctgcgcagcc tgatcgaaca tgggcggcga atccgggcgg tgatgcgcta tgtgccgcgc      1860
     cgctacaatc ccgcgatcat cgaggcgctg gcgatcaacg gcgcgctcga tccggaactc      1920
     agccatgacg cgcaggccga acggctggcc aacaccgtcc gctggatgga cgcgcaggac      1980
     gatgagggca ggtggagcgg ccggatcgca gaggagggcg gcttccattt cgagcggctt      2040
     tggcgcggcg tcaccgacca tcacatgatc gaggcgggct tcatcgggtc ggccgaagcg      2100
     cgcaagctgc acgccatcgc agccgaggag gcggacagct atcgcacctc cagccgcctg      2160
     gtgacggcca aggcggcggc cgccgccgag gaggccgggg aggacgaact gccggtcgcg      2220
     accaaggggt cggccacggt cacgcggccc agcgaattgc tggaggcgat cctgacggcc      2280
     gggcgcaagg ggctggcgat ccaacgatat aagggccttg gcgagatgaa cgcggaacag      2340
     ctttgggaaa ccacgctgga ccccgataac cgctccatgc tgcgggtgga ggtcgagcag      2400
     gcggacgtcg ccgacgaaat cttcacccgg ctgatgggcg atgtggtcga accgcggcgc      2460
     gagttcatcc aggacaacgc gctgaacgtc gccaatctgg acgtctga                   2508
//

If you have problems or comments...

PBIL Back to PBIL home page