(data stored in ACNUC7421 zone)

EMBL: AP010803.HISZ

AP010803.HISZ        Location/Qualifiers
FT   CDS_pept        complement(190491..191621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisZ"
FT                   /locus_tag="SJA_C1-01830"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit"
FT                   /note="ATP phosphoribosyltransferase involved in histidine
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01830"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95017"
FT                   /db_xref="GOA:D4YXD5"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXD5"
FT                   /protein_id="BAI95017.1"
FT                   /translation="MTTIPSGLLPEGLSDRLPPLAEASAWLARRVLDTVASHGYERVMP
FT                   PIAEFEDTLVSRLKSMKAQDLVRAIDPVSQRSLALRPDMTAQVGRIAATRLAAAPRPLR
FT                   LSYAGPVIRLRANQLRPERERFQIGAELIGSDSVAAAVEIVNVAIEALQAAGVTGITID
FT                   FTLPDLIDALAAGPLPLAPEEIEAVRAELDAKDAGALAAISPAAAAYLPLIEGTGPFHA
FT                   AMERLEALNADLGGAIDSRIAGLRAIAKPIGWDISLTLDPTERHGFEYQNWFGFSIFAE
FT                   GFTGEIGRGGSYAIIRADGSEEPAMGFSLYPDPLIDAGFGGEAPRRLFLPLHHDAARAA
FT                   QLRAEGWQTVAALTPQENGEALRCSHWLDGTEPRPY"
     atgaccacga ttccatccgg cctcctgcct gaaggacttt ccgaccgtct gccgccgctg        60
     gcggaggctt ccgcctggct tgcgcgccgc gtgctcgata ccgtggcgag ccacggctat       120
     gaacgcgtca tgccgcccat cgcggagttc gaggacacgc tggtcagccg cctcaaatcg       180
     atgaaggcgc aggatctcgt ccgcgccatc gacccggtgt cgcagcgcag cctggccctg       240
     cgcccggaca tgactgcgca ggtcggccgc atcgccgcca cccgcctggc cgccgcgccc       300
     cgcccgctgc gcctgtccta tgccggtccc gtcatccgcc tgcgcgccaa tcagctccgt       360
     ccggagcggg agcggttcca gatcggcgct gaactcatcg gcagcgacag cgtcgccgcc       420
     gccgtggaga tcgtgaacgt cgccatagag gcgttgcagg cggcgggcgt caccggcatc       480
     accatcgact tcaccctgcc ggacctgatc gacgcgctcg ccgccgggcc gctgccgctc       540
     gcgccggaag agatagaggc cgtccgcgct gaactcgacg ccaaggatgc gggcgcgctc       600
     gccgcgatca gcccggcggc cgccgcctat ctgccgctga tcgagggcac cggccccttc       660
     cacgcggcga tggaaaggct ggaggcgctg aacgccgatc tcggcggcgc catcgacagc       720
     cggatcgcgg gcctgcgcgc catcgccaag ccgatcggct gggacatcag cctgacgctc       780
     gatccgaccg agcggcacgg cttcgaatat caaaactggt tcggcttctc gatcttcgcg       840
     gaaggcttca ccggggagat cggccggggc ggcagctatg cgatcatccg cgccgacggg       900
     tcggaggaac cggccatggg cttctccctc tatcccgatc cgctgatcga cgcgggcttc       960
     ggcggcgagg cgcccaggcg gctgttcctg cccctgcacc atgacgccgc ccgcgccgcc      1020
     cagttgcggg cggaaggctg gcagacggtc gccgcgctga ccccgcagga aaatggcgag      1080
     gcgctgcgct gctcgcactg gctggatggc acggaaccgc gcccttactg a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page