(data stored in ACNUC7421 zone)

EMBL: AP010803.HLYD

AP010803.HLYD        Location/Qualifiers
FT   CDS_pept        300336..301508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlyD"
FT                   /locus_tag="SJA_C1-02860"
FT                   /product="HlyD-family secretion protein"
FT                   /note="type I secrection membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02860"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95120"
FT                   /db_xref="GOA:D4YXN8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXN8"
FT                   /protein_id="BAI95120.1"
FT                   /translation="MNYETSLVGDAPANVLGEQEERSVWRRRLTIGAVVAIVLIAVATW
FT                   VGMRGNGADAPANAAQAPVVTVISPGRSTVSNTVSATGSLAARVEMPVGVVGEGGAVTR
FT                   VLVQPGDWVRAGQVLATVERSVQTEQIRSLAAQVEVARADAKLAQAQLDRAKSLVSRGF
FT                   ISQADIDQRTATRDAANARVNVAAAQLAEQRARTGRLDIRAPAAGLVLTRAVEPGQIVS
FT                   AGSAVLFRMAKGGEMEMLAQVSEGDLAAIRPGNSATVTPVGGTAQFAGRIWQVSPVVDN
FT                   QTRQGIARIAIPYDPAIRPGGFASAAIVSGSGSAPMLPESAVQSDEKGNFVYVVNGRNE
FT                   VQRRDVKIGQVTDAGVSILNGLNGDERIVASAGAFLTPGQKVKPEAGKSK"
     atgaattacg aaacttcgtt ggtcggcgat gctccggcaa atgtccttgg cgagcaggag        60
     gagcgctccg tctggcgccg ccggctgacg atcggcgccg tggtcgcgat cgtgctgatc       120
     gccgtcgcca cctgggtcgg gatgcgcggc aacggcgccg acgcgcccgc caatgcggcg       180
     caggcgccgg tcgtgacggt gatcagcccc ggccggtcga ccgtgtcgaa caccgtcagc       240
     gccaccgggt cgctcgcggc gcgggtggag atgccggtgg gcgtggtcgg cgaaggcggc       300
     gcggtgacgc gggtgctggt gcagccgggc gactgggtgc gcgccgggca ggtgctggcg       360
     accgtcgagc gttccgtcca gaccgagcag atccgctccc tcgccgcgca ggtggaggtc       420
     gcgcgcgccg acgccaagct ggcgcaggcc cagctcgacc gcgccaagtc gctggtctcg       480
     cgcggcttca tcagccaggc cgacatcgac cagcgcaccg ccacccgcga cgcggccaat       540
     gcgcgcgtga acgtggccgc cgcgcaactg gccgagcagc gcgcccgcac cggccggctc       600
     gacatccgcg cccctgccgc cgggctggtg ctgacccgcg ccgtggaacc cggccagatc       660
     gtgagcgcgg gcagcgccgt gctgttccgc atggccaagg gcggggagat ggagatgctg       720
     gcccaggtca gcgagggcga cctggccgcg atccgtccgg gcaacagcgc caccgtgacc       780
     ccggtcggcg gcacggcgca atttgccgga cgcatctggc aggtgtcgcc ggtggtcgac       840
     aaccagaccc gccagggcat agcccgcatc gctatcccct atgatcccgc gatccgtccg       900
     ggcggcttcg cctccgccgc gatcgtcagc ggcagcggct ccgcgccgat gctgccggaa       960
     tcggcggtgc agagcgacga gaagggcaat ttcgtctatg tcgtcaacgg ccggaacgaa      1020
     gtgcagcggc gcgacgtcaa gatcggccag gtgaccgatg cgggcgtgtc gatcctgaac      1080
     ggcctcaacg gcgatgaacg catcgtggct tcggccggcg ccttcctgac gccggggcag      1140
     aaggtgaagc cggaagccgg caagtcgaaa tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page