(data stored in SCRATCH zone)

EMBL: AP010803.HTPX

AP010803.HTPX        Location/Qualifiers
FT   CDS_pept        264383..265312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="SJA_C1-02490"
FT                   /product="heat shock protein HtpX"
FT                   /note="Zn-dependent protease with chaperone function"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95083"
FT                   /db_xref="GOA:D4YXK1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXK1"
FT                   /protein_id="BAI95083.1"
FT                   /translation="MNGMKTAMLLSALTALFMALGYTLGGSGGAAIALLVAAGMNLFTF
FT                   WNADRIVLSMHNAREVDAQSAPEFYTLVAELARRAGLPMPRVYLIDQPHPNAFATGRDP
FT                   DHAAVAATTGLLSMLSRDEVAGVMAHELGHVRNRDTLIMTMVATIAGAISMLANFGLFF
FT                   RGGNQENGHGNIAATLLAVIVAPFAAMIVQMAISRTREYGADRAGAEISGNPRALASAL
FT                   AKISGRAETIPNPVAERNPAAAQLYIVPVHVSELFSTHPATEKRIAALEEMAGGAPLPR
FT                   RASALSPAASSAAPKGRKSSALDPLRRD"
     gtgaatggga tgaagacggc gatgctgttg tcggcgctga ccgcgctgtt catggcattg        60
     ggctatacgc tgggcggcag cggcggcgcg gcgatcgcgt tgctggtcgc ggcgggcatg       120
     aacctgttta ccttctggaa cgccgaccgg atcgtgctgt cgatgcacaa tgcgcgggag       180
     gtggatgccc agagcgcgcc cgaattctat accctcgtcg cggagcttgc ccggcgcgcc       240
     ggccttccca tgccccgcgt ctacctgatc gaccagccgc atcccaatgc cttcgcgacc       300
     ggccgcgacc cggaccatgc cgccgtcgcg gccaccaccg gcctgctgtc gatgctgagc       360
     cgcgacgaag tggcgggcgt catggcgcat gagctgggcc atgtgcgcaa tcgcgacacg       420
     ctgatcatga cgatggtggc gaccattgcg ggcgcgatct ccatgcttgc caatttcggc       480
     ctgttctttc gcggcggcaa tcaggaaaac ggccacggca atatcgccgc gaccctgctg       540
     gcggtgatcg tcgcgccctt cgcggccatg atcgtgcaga tggcgatcag ccgcacccgc       600
     gaatatggcg ccgaccgggc cggcgcggag atcagcggca atccccgcgc cctcgcctcc       660
     gccctcgcca agatttccgg ccgggcggaa acgatcccca atccggtggc ggagcgcaat       720
     ccagccgccg cgcagctcta catcgttccg gtgcatgtga gcgagctttt ctccacccat       780
     ccggcaacgg aaaagcgcat cgccgcgctg gaggagatgg cgggcggcgc gcccctgccg       840
     cggcgcgcat ccgccctgtc cccggccgcg tcctccgccg cgcccaaggg ccgcaaatcg       900
     agcgcgctcg atccgctacg ccgggattag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page