(data stored in ACNUC7421 zone)

EMBL: AP010803.LIGX

AP010803.LIGX        Location/Qualifiers
FT   CDS_pept        240236..241528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligX"
FT                   /locus_tag="SJA_C1-02290"
FT                   /product="DDVA O-demethylase"
FT                   /EC_number="1.14.-.-"
FT                   /note="phenylpropionate dioxygenase and related
FT                   ring-hydroxylating dioxygenases, large terminal subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95063"
FT                   /db_xref="GOA:D4YXI1"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXI1"
FT                   /protein_id="BAI95063.1"
FT                   /translation="MLSEEKNRQLTQVGPGTPMGELLRRYWMPIAAEGELDKKPVKAVR
FT                   LMGEDLVLYRDLGGQLGLTDRHCPHRRADLSYGFVEKCGIRCNYHGWLFDEQGACLEQP
FT                   YEDTVLGGGTRDKVSITAYPVRALGGLIWAYLGPSPAPELPEYEAFNWPNGFRQIILSD
FT                   IPCNWAQCQENSIDPVHFEWMHSNWSVRLKGEEGPYAPRHLKIGFEEFEHGFLYKRIRE
FT                   DTDEEHDLWSVGRAMIWPIGIFLGDHFEWRVPVDDENSLSVAWSFQRMPIESEPFVQER
FT                   IPYWRGPVTDAEGNWISSHVMNQDFIAWVGQGRIADRTKERLGRSDLGIGLMRRQLFAD
FT                   MEAVARGEDPKGIIRDPALAKNIPLPLVHAERYRSGMPREKLVAHPVLGRHLRAYPYQY
FT                   GQPTEVLESIWRAAGVTREDFGIGTDAEPME"
     atgcttagcg aggagaagaa ccgccagttg acccaggtgg gccctggcac ccccatgggt        60
     gaattgctgc gccgctactg gatgccgatc gccgccgagg gcgaactgga taaaaagccg       120
     gtcaaggccg tgcggctgat gggcgaggat ctggtcctgt atcgcgacct gggcggacag       180
     ctcggcctca ccgatcggca ttgcccccat cgccgcgccg acctctccta tggcttcgtg       240
     gagaagtgcg gcatccgctg caactatcat ggctggctgt tcgacgagca gggcgcctgc       300
     ctcgagcagc cctatgagga caccgtcctt ggcggcggca cccgcgacaa ggtgtcgatc       360
     acggcttatc cggtgcgcgc cctcggcggg ctgatctggg cctatctcgg tccgtcgccc       420
     gcgcccgagc tgccggaata tgaggcgttc aactggccca acggcttccg gcagatcatc       480
     ctctccgaca tcccctgcaa ctgggcccag tgccaggaga actcgatcga tcccgtgcat       540
     ttcgagtgga tgcactcgaa ctggagcgtc cggctcaagg gcgaggaggg cccctatgcc       600
     ccccgccatc tcaagatcgg cttcgaggag ttcgagcacg gcttcctcta caagcgcatc       660
     cgcgaggaca ctgacgagga gcatgatctc tggtcggtcg gccgcgcgat gatctggccg       720
     atcggcatct tcctgggcga ccatttcgaa tggcgcgtgc cggtggatga cgagaacagc       780
     ctgtcggtcg cctggtcgtt ccagcgcatg cccatcgaga gcgagccctt cgtccaggag       840
     cgcatcccct attggcgcgg gccggtgacc gacgcggagg ggaactggat ctccagtcat       900
     gtgatgaacc aggatttcat cgcctgggtc ggccaggggc ggatcgcgga tcgtaccaag       960
     gagcggcttg gccgcagcga tctcggcatc ggcctgatgc gccgccagct gttcgccgac      1020
     atggaggcgg tggcgcgggg cgaggatccc aagggcatca tccgcgatcc ggccctggcg      1080
     aagaacatcc cgctgccgct tgtccacgcc gagcgctatc gcagcggcat gccgcgcgag      1140
     aagctggtcg cccatccggt gctggggcgc cacctccggg cctatcccta tcaatatggc      1200
     cagccgaccg aggtgctgga atcgatctgg cgcgcggctg gggtgacgcg ggaagatttt      1260
     ggcatcggaa cggacgccga gccgatggaa tag                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page