(data stored in ACNUC7421 zone)

EMBL: AP010803.LINC

AP010803.LINC        Location/Qualifiers
FT   CDS_pept        complement(566609..567361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="linC"
FT                   /locus_tag="SJA_C1-05590"
FT                   /product="2,5-dichloro-2,5-cyclohexadiene-1,4-diol
FT                   dehydrogenase LinC"
FT                   /EC_number="1.1.1.-"
FT                   /note="gamma-hexachlorocyclohexane degradation /
FT                   short-chain dehydrogenase/reductase (SDR) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-05590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95393"
FT                   /db_xref="GOA:D4YYG1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:D4YYG1"
FT                   /protein_id="BAI95393.1"
FT                   /translation="MSDLSGKTIIVTGGGSGIGRATVELLVASGANVAVADINDEAGEA
FT                   VVAASGGKAAYFRCDIAQEEDVKALVAQTLAAFGGLDGAFNNAAIPQAGLPLAEVSLER
FT                   FRQSMDINVTGTFLCMKYQILAMIERGTKGSIVNTASAAGVVGVPMHGEYVGAKHAVVG
FT                   LTRVAAADYGKHGIRVNALVPGAVRTPMLQRAMDNDAGLEPYLNSIHPIGRFSEPHEQA
FT                   QAAVWLLSDAASFVTGSCLAADGGFTAI"
     atgtctgatt tgagcggcaa gacgataatc gtgacgggtg gtggcagcgg catcgggcgc        60
     gccaccgtgg aattgctggt ggccagtggt gccaacgtcg cggtggcgga catcaacgac       120
     gaggccggtg aggcggtcgt cgctgcgtct ggcgggaagg ccgcctattt ccggtgcgac       180
     atcgcacagg aagaggacgt gaaggcactt gtcgcgcaga ctctggcggc gttcggcggg       240
     cttgacggcg cgttcaacaa tgcggcgatc ccgcaggccg gactgccgct tgccgaagtg       300
     tcgctcgaac ggtttcggca gagcatggat atcaatgtaa ccggcacgtt cctgtgcatg       360
     aagtaccaga tccttgcgat gatcgagcgc gggacgaagg gatcgatcgt caacaccgca       420
     tccgccgctg gcgtggtcgg cgtgccgatg cacggcgaat atgtcggcgc gaagcatgcg       480
     gtggtcgggc tgacccgcgt ggcggcggca gactatggca agcacggcat tcgcgtgaac       540
     gcgcttgtgc ccggcgcggt gcgcacgcct atgctgcagc gcgcgatgga caatgatgcg       600
     ggccttgagc cctatctgaa ctcgatccac ccgatcggcc gtttcagcga accgcacgag       660
     caggcccagg ccgccgtatg gttgctgtcc gacgcggctt cgttcgtcac cggctcctgc       720
     cttgcagcag acggcggctt taccgcgatc tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page