(data stored in ACNUC7421 zone)

EMBL: AP010803.LUXR

AP010803.LUXR        Location/Qualifiers
FT   CDS_pept        complement(410441..411238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxR"
FT                   /locus_tag="SJA_C1-03990"
FT                   /product="LuxR-family transcriptional regulator"
FT                   /note="DNA-binding HTH domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03990"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95233"
FT                   /db_xref="GOA:D4YY01"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY01"
FT                   /protein_id="BAI95233.1"
FT                   /translation="MSAAGRSCAMPSAALIDAVRFSEPGGIGPAAERLRDAVMDLCGLR
FT                   TAVTHNVASREPMRDGNGAVLASEIFGFRGEEPRWWEVPQLALSSPIVHACRVEAEPFW
FT                   CNAHGFFTRLPNPLLDVIDLHDFRIRAMTAAAIVVPIHLPFGQIGAASFLSPEPEANDL
FT                   SDAYACAADALAVLARAFVQSYVKVTARARPGLGSISLTKREVECLRWAAAGKTNEEIG
FT                   IILGLQRTTVRFHIRSASVKLDAVNRDQTMFKAAQLGFLGMIN"
     atgtccgctg ccggccgttc ctgcgcgatg ccgtccgctg ccttgatcga tgcggtccgc        60
     ttttcggaac cggggggcat agggccggcg gcggagcggc tgcgcgatgc ggtgatggac       120
     ctttgcgggc tgcgcacggc ggtcacgcat aatgtggcct cccgcgaacc gatgcgtgac       180
     ggaaatggcg ctgtgctcgc cagcgagata ttcggttttc ggggcgagga gccgcgctgg       240
     tgggaggtgc ctcagcttgc cctttcctcg cccatcgttc acgcttgccg ggtggaggcc       300
     gaaccgttct ggtgcaacgc ccatggcttt ttcacccgcc tgcccaaccc gctgctcgac       360
     gtgatcgacc tgcacgattt ccgcatccgg gccatgacgg cggccgcgat cgtggttccg       420
     atccacctgc ccttcgggca gatcggcgcg gcgagcttcc tctcgcccga gccggaggcc       480
     aatgacctgt cggacgccta tgcctgcgcc gcggacgctc tggccgtgct ggcgcgggcc       540
     ttcgtgcaaa gctatgtcaa ggtgacggcg cgggcgcggc ccggtctggg gagcatatcc       600
     ctgaccaagc gcgaggtgga atgcctgcgc tgggcggctg ccgggaagac gaacgaggaa       660
     ataggcatca tcctgggcct gcaacgcacc acggtgcgat tccatatccg atcggcgtcc       720
     gtgaagctgg atgccgtgaa ccgcgaccag acgatgttca aggcggcgca gctcggcttc       780
     ctgggcatga taaactag                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page