(data stored in ACNUC7421 zone)

EMBL: AP010803.MAF

AP010803.MAF         Location/Qualifiers
FT   CDS_pept        complement(281465..281962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf"
FT                   /locus_tag="SJA_C1-02660"
FT                   /product="septum formation protein"
FT                   /note="nucleotide-binding protein implicated in inhibition
FT                   of septum formation"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95100"
FT                   /db_xref="GOA:D4YXL8"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXL8"
FT                   /protein_id="BAI95100.1"
FT                   /translation="MDPADLDETPLKGELPAAYAARVAAEKGALVAARHPGALVLSGDT
FT                   VVAAGRRILPKTESEAEARQCLQLLSGRRHRVLSAITLIDAEGKARHRLSTNIVTFKRL
FT                   DRAEIDAYLASQEWQGKAGGYAIQGRAAGLIRAIQGSHSAIMGLPLYETRALLRAAGYP
FT                   LD"
     gtggacccgg ccgacctcga cgaaacgccc ctgaagggag aacttcccgc cgcctacgcc        60
     gcccgcgtcg ccgccgaaaa gggggcgttg gtcgcggctc gccaccccgg cgcgctggtc       120
     ctttccggcg acacggtggt cgcggcgggc cgccgcatcc tgcccaagac ggagagcgag       180
     gccgaagcgc gccaatgcct ccagctcctc tccggccgcc gccaccgcgt gctgagcgcg       240
     atcaccctga tcgacgcgga gggcaaggcg cgccaccgcc tctcgaccaa tatcgtgacc       300
     ttcaaacgcc tggatcgcgc cgaaatcgac gcctatctcg cgtcgcagga atggcagggc       360
     aaggcaggcg gctatgcgat ccagggccgc gccgcaggcc tcatccgcgc catccagggc       420
     agccacagcg cgatcatggg cctgcccctc tacgaaaccc gcgcgctgct cagggcagcg       480
     ggctatccgt tggattga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page