(data stored in ACNUC7421 zone)

EMBL: AP010803.MARC

AP010803.MARC        Location/Qualifiers
FT   CDS_pept        complement(681585..682202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="marC"
FT                   /locus_tag="SJA_C1-06790"
FT                   /product="MarC-family membrane protein"
FT                   /note="multiple antibiotic resistance protein / integral
FT                   membrane protein of the MarC family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06790"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95513"
FT                   /db_xref="GOA:D4YYT1"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYT1"
FT                   /protein_id="BAI95513.1"
FT                   /translation="MTELFISAFVTLFVVIDPPGCAPIYASLTTCATQVQRRSMAIRAV
FT                   AIAAGILLLFALWGKQLLGTLGIELDSFRIAGGIMLFIIAMDMVFEKRTQRREDRAQKI
FT                   AETPEVEDVSVFPMAMPMIAGPGSIATVMLLMSRAEGLSERLVVIGAVVVTLVLMLASL
FT                   LAAGPIMALLGAKIEAVITRLLGVLLAALAAQFVIDGLKASF"
     atgacggaac tgttcatctc cgccttcgtc accctgttcg tagtgatcga tccgccgggc        60
     tgcgcgccga tctatgccag cctcaccacc tgcgcgacgc aggtccagcg gcgcagcatg       120
     gcgatccgcg ccgtcgccat cgcggccgga atcctgctgc tgttcgcgct ctggggcaag       180
     cagttgctgg gcactctggg gatcgaactg gacagcttcc gcatcgcggg cggaatcatg       240
     ctgttcatca tcgccatgga catggtgttc gaaaagcgca cccagcggcg cgaagaccgg       300
     gcgcagaaga tcgcggagac gcccgaggtg gaggatgtgt cggtcttccc catggcgatg       360
     ccgatgatcg ccggaccggg ttcgatcgcc acggtgatgc tgctgatgtc gcgggcggaa       420
     gggctgagcg aacgactggt ggtgatcggc gccgtggtcg tgacgctggt gctgatgttg       480
     gcgtcgctgc tggccgctgg gccgatcatg gcgctgctcg gcgccaagat cgaggcggtc       540
     atcacgcggc tgctgggcgt cctgctggcg gcactggccg ctcagttcgt gatcgacggg       600
     ctgaaggcca gtttctag                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page