(data stored in SCRATCH zone)

EMBL: AP010803.MGTE

AP010803.MGTE        Location/Qualifiers
FT   CDS_pept        659150..660577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="SJA_C1-06540"
FT                   /product="magnesium transporter"
FT                   /note="Mg/Co/Ni transporter MgtE (contains CBS domain)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95488"
FT                   /db_xref="GOA:D4YYQ6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYQ6"
FT                   /protein_id="BAI95488.1"
FT                   /translation="MSERADTAEPRPDELGDIAAEQAESRHDEDDRLKGEFVSAVLDAV
FT                   EADDRDLARELVSPLHPADIADLLELTPSERRGQVAAALGDLVGAEVLSELNDYVRDDL
FT                   LDALLPEQVAEFAAELDTDDAVAIIEDMEEADQQAVLDAMEPEDRAAIESALSYPEESA
FT                   GRLMQRDLVAVPEHMTVGQVIDYLRDNRDLTSDFWEIFVVDEAHKPIGTCQLSWVLTCP
FT                   RSVAMADLMKREQTLIPVDMDQEEVALRFQKYALISAAVVDGSGRLVGMITVDDIVHII
FT                   SEEAGEDILRLSGAGEGDINQPILETVRTRLQWLVVNLGTAILAASVVGLFQSTISKYV
FT                   VLAVLMPIVSGMGGNAGTQTMAVAVRALATNQLTSSNTIRQIAREFRIASANGTALGIL
FT                   IGVAVGLIYGNHDLGIVIALAMLINNLVAGLAGILVPVTLDRMNIDPAVSSAVFVTAMT
FT                   DVMGFFSFLGLATVWGL"
     atgagcgaac gagccgatac ggccgaaccc cggccggacg aactgggcga tatcgccgct        60
     gaacaggccg aatcccgcca tgacgaggat gaccggctga agggcgaatt cgtctccgcc       120
     gtgctggacg cggtggaggc ggacgaccgc gacctcgcgc gcgaactggt ctcgccgctg       180
     cacccggccg acatcgccga ccttctggaa ctcaccccct ccgaacggcg cgggcaggtg       240
     gcggcggcgc tgggcgacct ggtcggcgcg gaggttctgt ccgaactcaa cgattatgtc       300
     cgtgacgacc tgctcgacgc gctgctgccc gaacaggtgg ctgagttcgc cgccgaactg       360
     gacaccgacg acgccgtcgc catcatcgag gatatggagg aggccgacca gcaggccgtc       420
     ctcgatgcga tggagccgga agaccgcgcc gccatcgaaa gcgcgctctc ctatccggag       480
     gaatccgccg ggcgcctgat gcagcgcgac ctggtcgcgg tgccggagca tatgacggtc       540
     gggcaggtga tcgactatct gcgcgacaat cgcgacctga ccagcgattt ctgggaaatc       600
     ttcgtcgtcg acgaggcgca caagccgatc ggcacctgcc agttgagctg ggtgctgacc       660
     tgcccgcgca gcgtcgccat ggcggacctg atgaagcgcg aacagacgct gatcccggtc       720
     gacatggacc aggaggaggt cgcgctgcgc ttccagaaat atgcgctgat ctccgcagcg       780
     gtggtggacg gcagcgggcg gctggtcggc atgatcacgg tcgacgacat cgtccacatc       840
     atctccgagg aagcgggcga ggatatcctc cgcctgtccg gcgcgggcga gggcgacatc       900
     aaccagccga tcctggaaac ggtgcgcacg cgcctccaat ggctggtggt caacctcggc       960
     accgcgatcc tggcggcgtc ggtggtcggg ctgttccagt cgaccatctc caaatatgtc      1020
     gtgctggcgg tgctgatgcc catcgtgtcg ggcatgggcg gcaatgcggg gacgcagacc      1080
     atggcggtcg ccgtgcgcgc ccttgccacc aaccagctca ccagttccaa caccatccgc      1140
     cagatcgcgc gcgaattccg catcgccagc gccaacggca cggcgcttgg catattgatc      1200
     ggcgtcgcgg tggggctgat ctacggcaat cacgaccttg ggatcgtcat cgcgctcgcc      1260
     atgctgatca acaatctggt ggccgggctg gcgggcatat tggtgccggt gacgctcgac      1320
     cggatgaata tcgatccggc cgtatcctcg gctgtgttcg tgacggcgat gacggacgtg      1380
     atgggcttct tctccttcct cggccttgcc acggtctggg gtttgtaa                   1428
//

If you have problems or comments...

PBIL Back to PBIL home page