(data stored in ACNUC7421 zone)

EMBL: AP010803.MSCS

AP010803.MSCS        Location/Qualifiers
FT   CDS_pept        complement(687874..689133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscS"
FT                   /gene_synonym="aefA"
FT                   /gene_synonym="kefA"
FT                   /locus_tag="SJA_C1-06880"
FT                   /product="small-conductance mechanosensitive channel"
FT                   /note="potassium efflux system protein KefA"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95522"
FT                   /db_xref="GOA:D4YYU0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYU0"
FT                   /protein_id="BAI95522.1"
FT                   /translation="MTPGLHDLLSLLPGDPAVVHPLVALALAVAIHLVASAVARFASPR
FT                   LRRRFRALGEALAGHLRPILRHAIAAAVMALAVALWPIGDFAHLILGAALALSLSLLAV
FT                   HILRSLAIPRLAVLPIALLLFVMVLSGSSGGFAPVADMLDGVGLDLGKRRVTLLGLVSM
FT                   AAICVALFALVRLANRIVGRSITRAHGLDATQKLLAQKLAAIVVVVAAFFIGVDLLGID
FT                   LTAFAVFSGALGLAVGFGLQKTFGNLIAGIILLMDRSIKPGDVIVVGDSFGWVNKIGVR
FT                   AVSVITRDGKEHLIPNENLMTQEVENWSYSDRNVRVRIPVGIGYDSDLKLAQELMLRAA
FT                   QESPRVLRNPKPNVWLTAFGENRVEHDILVWISDPESGVGNVKSDVLGRLWLLFREHGI
FT                   TIPYPQRVIHAARDAAPPLP"
     atgacgcctg gcctgcacga cctcctgtcc ctgttgcccg gcgatccggc cgtcgtccac        60
     ccactggtcg cgctggcgct ggccgtcgcc atccatctgg tcgccagcgc cgtcgcccga       120
     ttcgcctcgc ctcgcctgcg ccgccgattc cgcgctttgg gggaggcgct ggccgggcat       180
     ctgcgcccga tcctgcgcca cgccatcgcc gccgccgtca tggcgctggc cgtcgccctc       240
     tggccgatcg gggatttcgc ccatctgatc ctgggcgccg cgctcgccct ctcgctctcg       300
     ctgctggcgg tgcacatatt gcgcagcctc gccattccgc gccttgcggt gctgccgatt       360
     gccctgctgc tgttcgtgat ggtcctttcc ggcagcagcg gcggcttcgc cccggtggcg       420
     gacatgctgg acggcgtggg cctggacctg ggcaagcggc gcgtcacgct gctggggctg       480
     gtcagcatgg cggcgatctg cgtcgcgctg ttcgccctag tccgccttgc caaccgcatt       540
     gtcgggcgca gcatcacccg cgcccatggg ctggacgcca cgcagaagct gctcgcgcag       600
     aagctggccg ccatagtcgt tgtcgtcgcc gcctttttca tcggcgtcga cctgctgggg       660
     atagacctga ccgccttcgc cgtcttttcg ggcgcgctgg ggctggcggt cggcttcggc       720
     ctgcaaaaga ccttcggcaa cctgatcgcc gggatcatcc tgctgatgga ccgatcaatc       780
     aagccgggcg acgtcatcgt cgttggcgac agcttcggct gggtgaacaa gatcggcgtg       840
     cgcgccgtca gcgtcatcac ccgcgacggc aaggagcatc tgatccccaa cgagaacctg       900
     atgacgcagg aggtggagaa ctggtcctat tccgaccgca acgtccgcgt ccgcatcccc       960
     gtcggcatcg gttatgacag cgacctgaag ctggcgcagg aattgatgct gcgcgccgcg      1020
     caggaaagcc cccgcgtgct gcgcaatccc aagcccaatg tctggctcac cgcctttggc      1080
     gagaatcgcg tcgaacatga catattggtg tggatcagcg atccggaaag cggcgtcggc      1140
     aatgtgaagt ccgatgttct cggccggttg tggctgctgt tccgcgaaca tggcatcacc      1200
     attccctatc cgcagcgcgt cattcacgcg gcgcgggacg cagcgccccc tctcccgtaa      1260
//

If you have problems or comments...

PBIL Back to PBIL home page