(data stored in SCRATCH zone)

EMBL: AP010803.MSRB

AP010803.MSRB        Location/Qualifiers
FT   CDS_pept        complement(40493..40897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrB"
FT                   /locus_tag="SJA_C1-00390"
FT                   /product="peptide-methionine (R)-S-oxide reductase"
FT                   /EC_number="1.8.4.12"
FT                   /note="conserved domain frequently associated with peptide
FT                   methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94873"
FT                   /db_xref="GOA:D4YWZ1"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWZ1"
FT                   /protein_id="BAI94873.1"
FT                   /translation="MDKLNLTDAEWRERLSPEQYHVLREGGTERAFTGKYNSNKADGLY
FT                   LCAGCGAELFDAEEKYDSGSGWPSFTAPVDIDAVDEIRDTSHGMIRTEVRCSNCDGHLG
FT                   HVFPDGPGVNGLRYCMNSASLDFKSRDEAG"
     atggacaagc tcaacctgac cgacgccgaa tggcgcgagc gcctttcccc cgaacaatat        60
     catgtcctgc gggaaggcgg cacggaacgg gccttcaccg gcaaatataa cagcaacaag       120
     gccgacggcc tctatctttg cgcgggctgc ggcgcggaac tgttcgacgc cgaggaaaaa       180
     tatgacagcg gatcgggctg gcccagcttc accgcgccgg tcgacatcga cgcggtcgac       240
     gaaatccgcg acaccagcca cggcatgatc cgcaccgaag tgcgctgttc gaactgcgac       300
     ggccatctcg gccatgtctt ccccgacggg ccgggggtca acggcctgcg ctattgcatg       360
     aacagcgcgt cgctggattt caaatcccgc gacgaagccg gatga                       405
//

If you have problems or comments...

PBIL Back to PBIL home page