(data stored in ACNUC7421 zone)

EMBL: AP010803.NDUFA9

AP010803.NDUFA9      Location/Qualifiers
FT   CDS_pept        complement(260501..261439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="NDUFA9"
FT                   /locus_tag="SJA_C1-02440"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex 9"
FT                   /EC_number="1.6.5.3"
FT                   /EC_number="1.6.99.3"
FT                   /note="bifunctional protein"
FT                   /note="putative nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95078"
FT                   /db_xref="GOA:D4YXJ6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXJ6"
FT                   /protein_id="BAI95078.1"
FT                   /translation="MGRVMKDSLVTVFGGGGFLGRHVAQALMARGARVRVAQRDLATAL
FT                   RVKPLGALGQTQFVAADIRKPESVARAVAGSDIVINLVGVLSSDFQGSHHDGAANVAKA
FT                   AAEAGVGALVHISAIGADAQSPSAYGRSKAAGEEAVKAAFPSATIIRPSIVFGPEDQFL
FT                   NRFAEIIRFTPVVPVIGANTRFQPVYVADVAQAIANAAENPGLHGGKTYELGGPQTYSM
FT                   LELNAWIAKAIGRERSLCPVPASIASLIALLPGGPITRDQLAMLGRDNVAAPGAKGLAD
FT                   LGVAPTPMPAVAEKWLVRYRRHGRFAGRVQA"
     atgggacgcg tgatgaagga cagtctggtt acggtgttcg gcggcggcgg ctttctgggg        60
     cggcacgtcg cccaggcgct gatggcgcgc ggcgcgaggg tgcgcgtggc gcagcgcgac       120
     ctggcgaccg ccctgcgcgt gaagccgctg ggcgcgctcg gccagacgca gttcgtcgcg       180
     gccgacatcc gcaagcccga aagcgtcgcc cgcgccgtcg cgggcagcga catcgtcatc       240
     aatctggtcg gcgtgctttc cagcgatttc cagggttcgc accatgacgg cgcggccaat       300
     gtcgcgaagg cggcggcgga agcgggcgtt ggggcgctgg tccatatctc cgccatcggg       360
     gccgacgcgc aaagcccgtc cgcctatggc cggtcgaagg cggcgggcga ggaagcggtc       420
     aaggcggcct tccccagcgc caccattatc cgcccgtcga tcgtcttcgg gccggaggac       480
     cagttcctca accgcttcgc ggaaatcatc cgcttcaccc cggtggtgcc ggtgatcggc       540
     gcgaacacca gattccagcc cgtctatgtc gccgacgtgg cgcaggccat cgccaacgcg       600
     gccgaaaatc ccggcctgca cggcggcaag acctatgaac tgggcgggcc gcaaacctat       660
     agcatgctgg aactcaacgc ctggatcgcc aaggccatcg gccgggaacg cagcctgtgc       720
     ccggttcccg cctccatcgc ttcgctgatc gccctgctgc cgggcgggcc gatcacgcgg       780
     gaccagttgg ccatgctggg cagggacaat gtcgccgccc ccggcgcgaa gggtctggcg       840
     gaccttggcg tcgcgcccac gccgatgccc gcggtcgcgg aaaaatggct ggtccgctac       900
     cgcaggcatg gccgcttcgc cgggcgggtc caagcctga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page