(data stored in ACNUC7421 zone)

EMBL: AP010803.NUSB

AP010803.NUSB        Location/Qualifiers
FT   CDS_pept        complement(294868..295314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="SJA_C1-02780"
FT                   /product="N utilization substance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-02780"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95112"
FT                   /db_xref="GOA:D4YXN0"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXN0"
FT                   /protein_id="BAI95112.1"
FT                   /translation="MNDRSKSRSAARLAAVQALYQLEMEGTPLHLLLHEFHQHRLGATI
FT                   EDVTYAQAEESFFDDVVQGVDRRREEIDALIVARLSKGWSLERLDKPMRQILRAGTYEL
FT                   LARKDVATGTAISEYVDVAHAFYDKREAGFVNGLLDAVAKDVRK"
     atgaacgacc gctccaaatc ccgctccgcc gcgcgcctcg ccgcggtcca ggcgctgtac        60
     cagctggaga tggagggcac gccgctccac ctgctgctgc atgaattcca ccagcaccgc       120
     ctgggcgcga ccatcgaaga cgtgacctat gcgcaggcgg aggagagctt cttcgacgat       180
     gtcgtgcagg gcgtggaccg ccgccgcgag gagatcgacg cgctgatcgt ggcgcgcctc       240
     tccaaggggt ggagcctgga gcggctcgac aagccgatgc ggcagatttt gcgcgcaggc       300
     acctatgaac tgctcgcccg caaggatgtg gcgaccggca ccgcgatcag cgaatatgtc       360
     gacgtcgccc acgccttcta cgacaagcgc gaggcgggct tcgtcaacgg cctgctggac       420
     gcggtggcga aggatgtgcg gaaatag                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page