(data stored in ACNUC7421 zone)

EMBL: AP010803.OPT

AP010803.OPT         Location/Qualifiers
FT   CDS_pept        complement(696078..698045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opt"
FT                   /locus_tag="SJA_C1-06940"
FT                   /product="oligopeptide transporter OPT"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06940"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95528"
FT                   /db_xref="GOA:D4YYU6"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYU6"
FT                   /protein_id="BAI95528.1"
FT                   /translation="MTGDSARAAPMAELTLRGVILGALITLLFTAANVYLGLKIGLTFA
FT                   TSIPAAVISMAVLRLFATGTILENNIVQTIASAAGTLSAIIFVLPGLVIIGWWQGFPYW
FT                   LSAFTIALGGILGVMYSVPLRRALVTGSDLPYPEGVAAAEVLKVGAGSREGLEENKRGL
FT                   AAIVASSVAAAAFSVLAKTKLIAEEAATFFKFGAGATSVSTSFSMALIGVGHLVGLSVG
FT                   VAMFFGLLISWVGLVPYLTAPLPSGADLSEIVGATFRMKARFIGAGTIGVAAIWTLLKI
FT                   LGPIVSGIRSALAAAKVRKGGNAGLLELTERDLPIGIVGGTILASLIPIAILLWLFAQG
FT                   GPIAANPVPIIGLTLAYILVAGIVIASVCGYMAGLIGASNSPISGVGILAVLGASLILA
FT                   AIYGSGGDPKQAQALIAYALFTTAIIFGIATISNDNLQDLKTGQLVGATPWKQQVALVL
FT                   GVIFGALVIPPVLDLLNSAFGFAGAPGAKETALPAPQAALISALAKGVLGGDLDWGLIG
FT                   FGAGIGVVVVAIDELLGKAGKLRLPPLAVGMGIYLPMALTLLIPVGAVIGHVYNRWALR
FT                   QSNPEFAERMGVLMATGFIVGESLFGVAFAGMVAATDSDAPLALVAENGWAVPLSILAF
FT                   FGVIAALYRRLRRWASAPLG"
     gtgacaggtg attcggccag ggcggccccg atggcggagc tgacgcttcg cggcgtgata        60
     ttgggcgcgc tcatcacatt gctgttcacg gcggcgaacg tctatctggg gctgaagatc       120
     ggcctgacct ttgccacgtc gatccccgcc gccgtgatat ccatggcggt gctgcggctg       180
     tttgcgaccg gcacgatcct ggaaaacaac atcgtccaga ccatcgcgtc ggcggcgggc       240
     accttgtccg cgatcatctt cgtgctgccg gggctggtca tcatcggctg gtggcagggc       300
     tttccctatt ggctctccgc cttcaccatc gcgctgggcg gcatattggg cgtcatgtat       360
     tcggtgccgc tgcgccgggc gctggtgacg ggatcggacc tgccctatcc cgaaggcgtg       420
     gccgccgccg aagtgctgaa ggtcggcgca ggctcccgcg aggggctgga ggagaataag       480
     cgcgggctgg ccgccatcgt cgccagttcg gtcgccgccg ccgccttctc cgtcctcgcc       540
     aagacgaagc tgatcgcgga ggaagccgcg acctttttca aattcggcgc gggcgcgacg       600
     agcgtctcca ccagcttttc catggcgctg atcggcgtcg gccatctggt cggcctgtcg       660
     gtgggcgtgg ccatgttctt cggcctgctg ataagctggg tcgggctggt gccctatctc       720
     accgcgccgc tgccttcggg cgcggacctt tcggagatcg tcggcgccac cttccgcatg       780
     aaggcccgct tcatcggcgc gggcaccatc ggcgtcgcgg cgatctggac gttgctcaag       840
     atccttggcc ccatcgtcag cggcatccgg tccgccctcg ccgccgccaa ggtgcgaaag       900
     ggcggcaatg ccgggctgct ggaactgacc gagcgcgacc tgcccatcgg catcgtcggc       960
     ggcaccattc tcgcctctct gatccccatc gccatcctgc tgtggctgtt cgcgcagggc      1020
     gggccgatcg cggccaatcc ggtgccgatc atcggcctga cgctggccta tatattggtc      1080
     gcgggcatcg tgatcgcgtc ggtctgcggc tatatggcgg gcctgatcgg ggcgtcgaac      1140
     agcccgattt ccggcgtcgg catccttgcg gtgctgggcg cttcgctgat cctggccgcg      1200
     atctacgggt cgggcggcga tccgaagcag gcccaggcgc tgatcgccta tgcgctgttc      1260
     acgaccgcca ttatctttgg gatcgcgacc atttccaacg ataatttgca ggatctgaag      1320
     accggccagt tggtcggcgc gaccccctgg aagcagcagg tcgcgctggt gctgggcgtg      1380
     atcttcggcg cgctggtgat cccgccggtg ctggacctgc tcaacagcgc cttcggtttc      1440
     gcgggcgcgc cgggcgccaa ggagaccgcc ctgcccgccc cgcaggcggc gctgatttcg      1500
     gcgctggcga agggcgtgct gggcggcgat ctcgactggg gcctgatcgg cttcggcgcg      1560
     ggcatcggcg tggtcgtcgt cgccatcgac gaactgctgg gcaaggctgg caagctgcgc      1620
     ctgccgccgc tggccgtggg catgggcatc tacctgccga tggcgctgac cttgctgatc      1680
     ccggttggcg cggtgatcgg gcatgtctac aaccgctggg cgctgcgcca gtccaacccc      1740
     gaattcgccg agcgcatggg cgtgctgatg gcgaccggct tcatcgtggg ggagagcctg      1800
     ttcggcgtgg ccttcgctgg gatggtcgcg gcgaccgaca gcgatgcgcc gctggcgctg      1860
     gtggcggaaa atggctgggc ggtgcccttg tcgatccttg ccttcttcgg ggtgattgcg      1920
     gcgctgtaca ggcggctgcg gcgttgggcg agcgcgccgt tggggtaa                   1968
//

If you have problems or comments...

PBIL Back to PBIL home page