(data stored in SCRATCH zone)

EMBL: AP010803.PAPC

AP010803.PAPC        Location/Qualifiers
FT   CDS_pept        715395..717707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="papC"
FT                   /locus_tag="SJA_C1-07060"
FT                   /product="P pilus assembly protein, porin PapC"
FT                   /note="PapC-like porin protein involved in fimbrial
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-07060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95540"
FT                   /db_xref="GOA:D4YYV8"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYV8"
FT                   /protein_id="BAI95540.1"
FT                   /translation="MKKRPLEPIMVALCLLSGPVFGQESDPARPPALTGPEPEMLLVEV
FT                   AVNGDLRPGEYLVARRHARWLMRPADLSRLRIAIGTDEAVTVEGERFIALPPAISAGLD
FT                   SVRQRLELNVPTDFFEGQKLSASNDRLPPTEGALAAFLNYDVSLNYQRGLNGSGFVETG
FT                   VSDDWGLLATTMGFGQGLGTGDVVRLESYYLRDDLSGLARLVVGDTVTAAPDWSRQVRF
FT                   GGVRLGTDFSLQPNLITFPTPSFAGRTAVPSNVELLVNNASRYQGQVDQGPFSINQAPL
FT                   VTGAGEVTIVLQDALGVERRVRTSYYVSPRLLARGLAAWSLEAGAERQDYGIRSFAYRN
FT                   PFVAGTYRRGIADWLTADGRAELSKDVRMAGAGVTMVWAPVGEFGLVVAGSQGGDGRGG
FT                   MYRLFYSRVSPAWNVAVSYQRASRRFDQLGIDRDQDRIAKQMQASAGVSLGGGGSVALT
FT                   WTDLRYGDGNGAKIASANYSLSLGSRAFLNLYAIRSDLRDAGHQTLFGLGLTLPLGQRS
FT                   SGYVQADRRNQLAELRQTPPMEGGWGYRLSAGTGDSDRQQAEARWRGDVGEVSLEVARQ
FT                   GSEEGVRMLASGGLLIAGGGIRPTRRIEGGLGVVEVPGHANVRIYQENRLITRTNSNGI
FT                   AIIPDLRPYEANRLSLAPSDLPLDTQMPDDRMIVVPRYRGAVAARFSIERRNPATVIVT
FT                   MANGQPVEPGADVMASDGSQLFVGQQGEIFLPDFKPGTTLKIDIGQGECQVTLPAAKAG
FT                   ETLPRIGPVVCHHGDAR"
     atgaagaagc gaccccttga gccgatcatg gtcgcgctct gccttctgtc cggccctgtc        60
     tttggccaag agtccgatcc cgctcgcccg ccagccttga caggacctga accagaaatg       120
     ttgctggtgg aagtggcggt caacggcgat ctgcgtcccg gcgaatatct ggtcgcgcga       180
     cgacacgcgc gctggctgat gcgaccggcc gatctttccc gattgcgaat cgctatcggc       240
     acagatgaag cagtgacggt cgagggagaa agattcatcg ccctgccgcc cgccatttcc       300
     gccgggctcg acagtgtgcg gcaacggttg gaattgaacg tgccgacgga ttttttcgaa       360
     ggtcaaaagc tgtccgcatc caatgatcgg ctcccgccga cggagggtgc ccttgccgct       420
     ttccttaact atgatgtttc tctgaactat cagcgtggac tgaacggaag tggatttgtc       480
     gagaccgggg tgtccgacga ctgggggttg ctggcaacca cgatgggctt cggacagggt       540
     ttgggcacag gcgatgtggt tcggctggag agttattatc tgcgtgacga tctttcgggc       600
     cttgccaggt tggtcgtggg cgacacggtc acggcggcgc cggattggtc gcggcaggtt       660
     cgcttcgggg gcgtgcgtct cggtacggac ttcagtttac agcccaacct tattaccttt       720
     ccgacgcctt cttttgccgg acgtactgcc gttccttcca atgtcgaact actggtcaac       780
     aacgcatccc gctaccaggg ccaggtcgat cagggaccct tttcgattaa ccaggcgccg       840
     ctggtcacgg gggcaggcga agtcacgatc gtgctgcaag acgcgctggg ggtcgaacga       900
     cgggtaagga ccagctatta tgtcagcccc aggctgctcg cacgaggcct tgcggcctgg       960
     tcgctggaag cgggagccga gcgacaggat tatggcatcc gcagcttcgc ctaccgcaat      1020
     cctttcgtcg cgggcacata ccgacggggt atagcggatt ggttgacggc cgatgggcga      1080
     gcagagctta gcaaagatgt gcgcatggcg ggggctggcg tcacaatggt ctgggcgcct      1140
     gtgggcgaat tcggcctggt agtcgcggga tcgcaaggag gggatgggcg aggtgggatg      1200
     tatcgccttt tctacagccg tgtgtcgccc gcctggaatg tggcggtcag ctatcagcgc      1260
     gcgtcgcgcc gcttcgacca gctcggcatt gatcgcgatc aggaccgcat cgccaaacag      1320
     atgcaggcat cggccggcgt gtcgctgggg ggcggcggca gcgtcgcgct gacctggaca      1380
     gaccttcgct acggcgatgg caacggggcc aagatcgcct ccgccaacta tagcctgtcg      1440
     ctgggcagcc gcgcctttct gaacctttat gcgatccgca gcgacctgcg agacgcggga      1500
     catcagactt tgttcggcct tggactgact ctaccgctgg gtcagcgcag cagtggctat      1560
     gttcaggcgg accgccgcaa ccagctggcg gagctgcggc agacgccccc gatggaggga      1620
     ggctggggct atcgcctatc ggcaggcaca ggtgacagcg accggcagca ggcggaagcg      1680
     cgatggcgcg gggatgtcgg cgaagtcagc ctggaagtgg cccgtcaggg gagtgaggag      1740
     ggcgtccgca tgctcgccag cggcggcttg ctgattgccg gcggcggcat tcgccccacg      1800
     cgacggatcg aaggcgggct tggtgtggtg gaggtgccgg ggcatgccaa tgtccgcatc      1860
     tatcaggaaa accggctgat cacccggaca aactccaatg gaatcgcgat cattcctgac      1920
     cttcgccctt atgaggccaa tcgactttcg ctggcgccgt ccgatctgcc gttagacacg      1980
     caaatgcccg atgaccgcat gatcgtggtg cctcggtatc ggggcgcggt ggctgcgcgc      2040
     ttctccatcg aacggcggaa ccccgccacc gtcattgtta ccatggcgaa cggtcagccg      2100
     gtcgaaccgg gagcggacgt catggcgagc gacggaagcc agctgttcgt tggccagcaa      2160
     ggcgaaatat tcctgcctga cttcaagccg gggaccacgc tgaaaatcga tatcggtcag      2220
     ggggaatgtc aggtcacctt gccggccgca aaggcgggcg agaccctgcc acggatcggc      2280
     cctgtcgtct gccatcacgg tgatgcgcga tga                                   2313
//

If you have problems or comments...

PBIL Back to PBIL home page