(data stored in ACNUC7421 zone)

EMBL: AP010803.PAPD

AP010803.PAPD        Location/Qualifiers
FT   CDS_pept        714671..715414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="papD"
FT                   /gene_synonym="fimC"
FT                   /locus_tag="SJA_C1-07050"
FT                   /product="P pilus assembly protein, chaperone PapD"
FT                   /note="putative pili assembly chaperone transmembrane
FT                   protein/fimbrial chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-07050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95539"
FT                   /db_xref="GOA:D4YYV7"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYV7"
FT                   /protein_id="BAI95539.1"
FT                   /translation="MIGQNLRGMIAALLASFPAAPLCAASLKIFPVRLLLTQDEPVQTM
FT                   TIANSSDTPTRVQLHIYSWRQDGEEDRLEETREVLANPGQFEIPAGGTQIARFGLRTGI
FT                   GPQEKSYRVILEEIPGMRAALPGQVETLLRVSIPIFVPPSRPSGRLSWRAWPSGNRNLT
FT                   LAIRNDGNAHVQINRLSLTKRNRREVGRQDMSTYLLPGSERRVTVPLGAPVAAGEALTV
FT                   IAMTDQAEMSADLVTEGPRHEEATP"
     gtgatcggcc aaaatttgcg cggaatgatt gccgccctgc tcgcttcgtt tccggcagct        60
     ccgctttgtg cggcaagcct gaagattttc ccggtacgtc tgctgctgac ccaggacgag       120
     ccggtgcaga cgatgacgat cgcaaatagc agtgacacgc ccactcgcgt gcaactgcac       180
     atctatagct ggcgccagga cggcgaggaa gaccggctgg aggaaactcg ggaggtgctt       240
     gccaatccgg ggcagttcga aattcctgct ggcggcacgc agatcgcgcg tttcggattg       300
     cgtacaggga ttggcccgca ggaaaaaagc tatcgcgtca ttctggaaga gatacctgga       360
     atgcgcgcgg ccctgcccgg gcaggtcgaa accctgctgc gcgtcagtat tccgatcttc       420
     gttcccccct cgcgtcccag cggccgcctg tcctggcgcg cttggccttc gggcaaccgc       480
     aacctcacgc ttgcgatccg gaacgacggc aatgcgcatg tccagatcaa tcggctgagc       540
     ctgacgaagc gcaatcggcg agaggtgggc cggcaggaca tgtccaccta tctgctgccc       600
     ggatcagaac ggcgcgtgac tgtgccgctc ggcgcgccgg tcgccgcggg agaggcgctc       660
     accgtcatcg cgatgaccga tcaggccgaa atgagcgcgg acctggtaac agaagggccg       720
     cgccatgaag aagcgacccc ttga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page