(data stored in ACNUC7421 zone)

EMBL: AP010803.PARA

AP010803.PARA        Location/Qualifiers
FT   CDS_pept        complement(26688..27470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="SJA_C1-00270"
FT                   /product="chromosome partitioning protein ParA"
FT                   /note="ATPase involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94861"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWX9"
FT                   /protein_id="BAI94861.1"
FT                   /translation="MIRIAIANQKGGVGKTTTAINLATGLAATGLRVLLVDLDPQGNAS
FT                   TGLGVNQSDREQSSYDLLVGNCALEDAIISTRVPKLDIVPATQDLSGAEIELIEYEERT
FT                   HRLERVLAEAQPGRWDICLIDCPPSLGLLTINAMVAAQSLLVPLQCEFFALEGLSQLLQ
FT                   TVERIRGRFNPGLSIMGVALTMYDRRNRLTDQVADDVRACLGDLVFSTVIPRNVRLSEA
FT                   PSHGVPALIYDFRCSGSEAYMRLARELIARLPRQEVAA"
     atgatccgta ttgccatcgc caatcaaaag ggcggcgtcg gaaaaaccac cactgccatc        60
     aatctggcca cggggttggc cgccaccggg cttcgcgtcc tgctggtcga tctcgatccc       120
     cagggcaacg cctcgaccgg cctgggcgtc aaccagtccg accgcgaaca atccagctat       180
     gacctgctgg tcggcaattg cgcgctggaa gatgcgatca tcagcacgcg cgtgcccaag       240
     ctcgacatcg tccctgcgac ccaggatctt tccggggcgg agatcgaact gatcgaatat       300
     gaggaacgca cccaccggct ggagcgcgtg ctggcggagg cccagcccgg ccgctgggac       360
     atttgcctga tcgactgccc gccctcgctc ggcctgttga cgatcaacgc gatggttgcg       420
     gcgcaatccc tgctggtgcc gctgcaatgc gaatttttcg cgctggaggg gttgtcgcaa       480
     ctgctccaga cggtggagcg cattcgcggc cgcttcaatc ccggcctttc catcatgggc       540
     gtggcgctca ccatgtatga ccggcgcaat cgcctgaccg accaggtggc cgacgatgtg       600
     cgggcttgcc tgggcgatct ggtcttttcc acggtcattc cgcgcaatgt gcgcctgtcc       660
     gaagcgccca gccatggtgt gccggccctc atctacgatt tccgctgttc gggatcggaa       720
     gcctatatgc gtctggcgcg tgaactgatc gcgcgcctgc cccggcagga ggttgctgct       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page