(data stored in ACNUC7421 zone)

EMBL: AP010803.PBP

AP010803.PBP         Location/Qualifiers
FT   CDS_pept        complement(38312..40381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp"
FT                   /locus_tag="SJA_C1-00380"
FT                   /product="penicillin-binding protein"
FT                   /EC_number="2.4.1.129"
FT                   /note="membrane carboxypeptidase (penicillin-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94872"
FT                   /db_xref="GOA:D4YWZ0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWZ0"
FT                   /protein_id="BAI94872.1"
FT                   /translation="MARSSSEPRGRVKKWLIRGVKIGLVGFLSAAIAVVVAVAIAYQSL
FT                   PDYESLKSSPNGQMIRVHAADGSVIVSLGPSFGRWLSYDQIPTVMVDAMVSTEDKRYYL
FT                   HPGVDPIGMARAAWVAMERRGSGRRWQGASTITQQVTRNIFLNNSYSWGRKVREMVLAL
FT                   ALERKFSKRQILELYLNKVYFGGGAYGIDAASRKFFGHPATALNLPEAAIVAGLVKAPS
FT                   SYSPTADADAAIGRAGVVLDLMQENGKISAAERTAANLQDVKMAPEPPQNSVRYFTDWA
FT                   LPQLDTLIDEPNEPLEVYTTIDLGMQKAATAAIQANVPSGTQGALVSLDRDGAVRAMVG
FT                   GLDYVSSNYNRATTATRQPGSAWKIFVYMAALEAGYTPDTGVTDSPVDINGWKPRNSNG
FT                   RFSGDIDIRTAFAYSVNTVAAKLGVEVGFPTVADMARRFGVTTPINTHPSMVLGTSDVR
FT                   LIDMTRAFASIARKGVAVTPYGITKVTTAEGRVLYEHQDDTSRVLVAPWVAAGMTDLMQ
FT                   TAVSTGTGRAAQIGRPVAGKTGTTSSNKDGWFLGFSSGITTGVWMGRDDARAVGVLQGG
FT                   RAPARAFADYMKIAVAKRPVEQFETQVTLPEWQLEPDEEAYYGQPDGGTDGGMMVDENG
FT                   LPIERGQQPDEDAQPDDSGQPTPNPADRPQPPRLDQQWIDNVLGRNRQQQQPQH"
     atggcacgat cgagcagcga accgcggggc agggtgaaga aatggctgat aaggggcgtg        60
     aaaatcggcc ttgtcggctt cttgagcgcg gcgatcgcgg tcgtggtggc ggtggcgatc       120
     gcttatcagt cgctgcccga ctatgaatcg ctgaaatcct cccccaacgg ccagatgatc       180
     cgcgttcatg cggcggacgg cagcgtcatc gtctcgctcg gccccagctt cggccgctgg       240
     ctgagctatg accagattcc cactgtcatg gtcgacgcga tggtctcgac cgaggacaag       300
     cgttactatt tgcaccccgg cgtcgacccc atcggcatgg cccgcgccgc ctgggtggcg       360
     atggagcggc gcggcagcgg ccgccgctgg cagggcgcgt ccaccatcac gcagcaggtg       420
     acgcgcaaca tcttcctcaa caacagctat agctggggcc gcaaggtccg ggaaatggtg       480
     ctggccctcg cgctggagcg caaattctcc aagcggcaga tcctcgaact ctatctcaac       540
     aaggtctatt tcggcggcgg cgcctatggc atcgacgccg ccagccgcaa atttttcggc       600
     catcccgcaa ccgccctgaa cctgccagaa gccgccatcg tcgccggtct ggtgaaggcc       660
     ccctccagct attcccccac cgccgacgcc gacgctgcca tcggccgcgc cggggtggtg       720
     ctggacctga tgcaggaaaa tggcaagatc agcgcggccg aacgcaccgc cgccaatctc       780
     caggacgtga agatggcgcc cgaaccgccg cagaacagtg tgcgttactt caccgactgg       840
     gcgctgccgc aactcgacac gctgatcgac gaacccaatg aaccgctgga ggtctacacg       900
     accatcgatt tgggcatgca gaaggcagcg accgcggcga tccaggcgaa cgtgcccagc       960
     ggcacgcagg gcgcgctggt ctcgctcgac cgcgacgggg cggtgcgggc gatggtcggc      1020
     ggcctcgact atgtgagttc caactacaac cgcgccacca ccgcgacgcg ccagccgggc      1080
     tcggcctgga agatctttgt ctatatggcg gcgctggagg cgggctatac ccccgacacc      1140
     ggcgtcaccg acagcccggt cgacatcaac gggtggaagc cgcgcaacag caacggacgc      1200
     ttctccggcg acatcgacat ccgcaccgcc ttcgcctatt cggtcaacac cgtggcggcg      1260
     aagctgggcg tggaggtcgg cttccccacc gtcgccgaca tggcccgccg cttcggcgta      1320
     acaacgccga tcaacacgca cccctcgatg gtgctgggca cgtccgacgt gcggctgatc      1380
     gacatgaccc gcgccttcgc ctccatcgcg cgcaagggcg tggcggtgac gccctatggc      1440
     atcaccaagg tgacgaccgc cgaaggccgt gtcctctacg aacatcagga cgacaccagc      1500
     cgcgtgctgg tcgccccctg ggtcgcggcg ggcatgaccg acctgatgca gaccgccgtc      1560
     agcaccggca ccggccgggc ggcgcagatc ggccggcccg tcgcgggcaa gaccggcacg      1620
     accagcagca acaaggacgg ctggttcctg ggcttttcca gcggcatcac caccggcgtc      1680
     tggatgggcc gcgacgacgc ccgcgccgtg ggcgtgctcc agggcggccg cgcccccgcc      1740
     cgcgccttcg ccgactatat gaagatcgcc gtcgccaagc gcccggtcga acagttcgaa      1800
     acccaggtga cgctgcccga atggcagttg gaaccggacg aggaggccta ttacggccag      1860
     cccgacggcg gaacggacgg cggcatgatg gtcgacgaaa acggcctgcc gatagagcgc      1920
     gggcagcagc cggacgagga cgcgcagccc gacgacagcg gccagccaac gcccaacccc      1980
     gcagaccgcc cccagccgcc gcgcctggac cagcaatgga tcgacaatgt gctgggccgc      2040
     aaccggcaac agcagcaacc gcagcactag                                       2070
//

If you have problems or comments...

PBIL Back to PBIL home page