(data stored in ACNUC7421 zone)

EMBL: AP010803.PDXJ

AP010803.PDXJ        Location/Qualifiers
FT   CDS_pept        complement(671141..671878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxJ"
FT                   /locus_tag="SJA_C1-06670"
FT                   /product="pyridoxine 5-phosphate synthase"
FT                   /EC_number="2.6.99.2"
FT                   /note="pyridoxal phosphate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-06670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95501"
FT                   /db_xref="GOA:D4YYR9"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:D4YYR9"
FT                   /protein_id="BAI95501.1"
FT                   /translation="MSRTPAHLRLGVNIDHVATIRNARGGTHPDPVKAALLAAKAGADG
FT                   ITAHLREDRRHIRDEDIATLMAALTVPLNLEMAATQEMLGIALRHRPHAACIVPEKREE
FT                   RTTEGGLDAAGQIDALHPIVDALGKAGVRVSLFIEPDAAQIEAAMRLGAPVVELHTGRY
FT                   AHLEGSERAEELRRLADAAALAAKNGIEPHAGHGLTFDNVGPVAAIPQIAELNIGHFLI
FT                   GEAIFGGLESSIREMRRQMDLAR"
     atgtcccgaa cccccgctca tctgcgcctg ggcgtcaaca tcgatcatgt ggcgaccatc        60
     cgcaacgcgc gcgggggaac gcatcccgac ccggtcaagg ccgcgctgct ggcggccaag       120
     gcgggcgccg acggcatcac cgcccatctg cgcgaggacc ggcggcatat ccgggacgag       180
     gacatcgcca cgctgatggc ggcgctgacg gtgccgctga acctggagat ggcggcgacg       240
     caggaaatgc tgggcatcgc gctgcggcat cggccgcatg ccgcctgcat cgtgccggaa       300
     aagcgggagg agcggaccac cgaaggcggg ctggacgccg ccgggcagat cgacgctctc       360
     cacccgatcg tcgacgcgct gggcaaggcg ggcgtgcgcg tcagcctgtt catcgaaccc       420
     gacgccgcgc agatcgaggc ggccatgcgc ctgggcgcgc cggtggtaga actgcacacc       480
     ggccgctacg cgcatctgga agggtccgaa cgggcggagg aattgcggcg gctggccgac       540
     gccgccgcgc tggcggcgaa gaacggcatc gaaccccatg ccggccatgg cctgactttc       600
     gacaatgtcg ggccggtcgc ggcgatcccg cagatcgccg aactcaatat cgggcatttc       660
     ctgatcgggg aggcgatctt cggcgggctg gagagcagca tccgcgaaat gcgccgccag       720
     atggacctgg cgcgttga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page