(data stored in ACNUC7421 zone)

EMBL: AP010803.PE1

AP010803.PE1         Location/Qualifiers
FT   CDS_pept        154..975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00010"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94835"
FT                   /db_xref="GOA:D4YWV3"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWV3"
FT                   /protein_id="BAI94835.1"
FT                   /translation="MSRIHLHLLSDSTGETLENIAKAAIGAFENVEAVRHFWPMVRSDV
FT                   HLDRIMEEIAANPGLVLFTLSNHQLRRRLETRCRALGLPHVAALDSVTDALSNILGQET
FT                   RNRPGRKHILDEAYFARIEAIQFTIAHDDGVGHENWEEADIVLAGVSRASKTPTSIYLA
FT                   NRGYKTANIPLVIQSPPPPALYSLKHPMVVGLTVSPERLVQIRRNRLLSLNQAPETSYV
FT                   NLDKVQEELAFARRMFADNGWPVIDMTRRSIEEAAAAIINLFNDRVLAEGA"
     atgtcgcgca tccatctcca cctgctttcg gactccaccg gcgagacgct ggagaatatc        60
     gccaaggcgg ccatcggcgc gttcgagaat gtggaggcgg tgcgccattt ctggccgatg       120
     gtccgctccg acgtccatct cgaccgcatc atggaggaaa tcgccgccaa tccgggcctc       180
     gtgctcttca ctttgtccaa ccaccagctc aggcggcggc tggagacgcg ctgccgggcg       240
     ctcggcctgc cgcatgtcgc cgcgctggac agcgtgaccg acgccctttc caacatattg       300
     gggcaggaaa cccgcaaccg ccccggccgc aagcatatcc tggacgaagc ctatttcgcc       360
     cggatcgagg ctatccagtt caccatcgcc catgacgacg gcgtcggcca tgaaaattgg       420
     gaggaggccg atatcgtgct ggcgggcgtc tcccgcgcct ccaagacgcc gacctccatc       480
     tatctcgcca atcgcgggta caagaccgcc aatatcccgc tggtgatcca gtcgccgccg       540
     ccgcccgccc tctattcgtt gaagcatccg atggtggtgg ggctgacggt cagcccggaa       600
     cggctggtgc agatccgccg aaatcgcctg ctctcgctca accaggcgcc cgaaaccagc       660
     tatgtcaatc tggacaaggt gcaggaggaa ctggccttcg cccgccgcat gttcgcggac       720
     aatggctggc cggtgatcga catgacccgc cgctccatcg aggaagcggc ggccgccatc       780
     atcaacctgt tcaacgaccg cgttctggcg gaaggagcat ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page