(data stored in SCRATCH zone)

EMBL: AP010803.PE103

AP010803.PE103       Location/Qualifiers
FT   CDS_pept        103712..104032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94937"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX55"
FT                   /protein_id="BAI94937.1"
FT                   /translation="MLAILADLLRRVDGLAGERGHVSVARLRDEIDRIRHIARAFHLDG
FT                   VGSLAGTLQSALSLQGAGPVVMSYLDLMRDAISAEMPAAAEVLAMPVAARPAVGPGARL
FT                   TA"
     atgctggcca ttcttgccga tctgctgagg cgggtcgacg ggcttgcggg ggaacggggc        60
     catgtatcgg tcgcgcggct gcgcgacgag atcgaccgga ttcgccatat cgcccgcgcc       120
     ttccacctgg atggggtggg aagcctggcc ggcaccctgc aatcggcgct gtcgctgcaa       180
     ggggcggggc cggtcgtcat gtcctatctc gacctgatgc gcgacgcgat ctcggccgaa       240
     atgccggcgg cggcggaggt tctggcgatg cccgtcgccg ccaggccggc ggtcgggccg       300
     ggcgcgcgcc tgaccgcctg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page