(data stored in ACNUC7421 zone)

EMBL: AP010803.PE104

AP010803.PE104       Location/Qualifiers
FT   CDS_pept        104049..104615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01040"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94938"
FT                   /db_xref="GOA:D4YX56"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX56"
FT                   /protein_id="BAI94938.1"
FT                   /translation="MDALLIALLGCLLAETGDKGQLLAHALAERFRRDGAVIAGIVAAA
FT                   LANAAIGAAAGAFIAPMLGTDGRLLFLALALIFLAVGMFWPTKQPDPLANWRLGPFLTS
FT                   ALGLFILGFGDGAQFLILGIAVRTADPFLAAAGGAIGIIAATVLVVLLRGPTFKALPLR
FT                   GIRLGGGVLVLLAGVAAAVSALHLA"
     atggatgcct tgctgatcgc gctgcttggc tgcttgttgg ccgaaaccgg ggacaagggg        60
     caattgctgg cgcatgcgct ggccgaacgc ttccggcgcg acggagcggt gattgcggga       120
     atcgtggcgg cggcgctggc caatgccgcc atcggcgcgg cggcgggcgc cttcatcgcg       180
     ccgatgctgg ggaccgacgg gcggctgctt ttcctggcgc tggcgctgat cttcctggcg       240
     gtcggcatgt tctggccgac gaaacagccc gatcctctgg cgaactggcg gctcggcccc       300
     tttctgacca gcgcgctcgg cctcttcatc ctcggcttcg gggacggcgc gcagttcctg       360
     atcctgggaa tcgccgtgcg gacggccgac cccttccttg ccgcagccgg cggggccatc       420
     ggcatcatcg ccgcgacggt tctcgtcgtc ctgctgcgcg gcccgacgtt caaggcgctg       480
     ccgctgcgcg gcatccggct gggcggcggg gtgctggtgc tgctggccgg cgtggcggcg       540
     gcggtgtctg cgctgcatct cgcctga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page