(data stored in ACNUC7421 zone)

EMBL: AP010803.PE108

AP010803.PE108       Location/Qualifiers
FT   CDS_pept        complement(107696..108481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01080"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94942"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX60"
FT                   /protein_id="BAI94942.1"
FT                   /translation="MSEPAALTPEEGRLPLESAFNLRDFGGYATADGRCVKRGMLYRSG
FT                   TMALLTDGDADHLRSLGIRAICDFRRGNERTAEPTLWHGADVDYFCRDYTESSGLLGEM
FT                   LQREGATADDMRRTMIALYRMIPVDHAASYRAMFERIADGRVPLLINCSAGKDRTGVGA
FT                   ALILAALGVPRPTIVQDYLATNAHADWDWLLAQRDTLVARMRLAGADMLEPLLRAESAY
FT                   LDSFFAALDESHGGVDDYLNDMLGVDAAARDAMRGMLLD"
     gtgagcgaac ccgccgccct gacgccggag gaaggccgcc tgccgctgga gagcgcgttc        60
     aacctgcgcg acttcggcgg ctatgcgacg gccgacgggc gctgcgtgaa gcgcggcatg       120
     ctctatcgat cgggcacgat ggcgctgctg acggacgggg atgcggacca tctccgctcg       180
     ctcggcatcc gggcgatctg cgatttccgc cgcggcaatg agcggacggc cgaacccacg       240
     ctctggcacg gggcggatgt cgattatttc tgccgcgact atacggaaag cagcggcctg       300
     ttgggcgaga tgctccagcg cgagggcgcc acggcggacg atatgcggcg gacgatgatc       360
     gccctttatc gcatgatccc ggtggaccat gccgcatcct atcgcgccat gttcgaacgg       420
     atcgcggacg gtcgcgtgcc gttgctgatc aactgttcgg cgggcaagga ccgcaccggg       480
     gtcggcgcgg cgctgatcct ggcggcgctc ggcgtgccgc gcccgaccat cgtccaggat       540
     tatctggcga ccaacgccca tgccgattgg gactggctgc tggcgcagcg cgatacgctg       600
     gtggcgcgga tgcggctggc gggggccgat atgctcgaac cactgctgag ggcggaatcg       660
     gcctatctgg attccttctt cgcggcgctg gatgaaagcc atggcggcgt ggacgactat       720
     ctgaacgaca tgctgggcgt cgacgcggcg gcgcgggatg cgatgcgcgg gatgctgctg       780
     gactga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page