(data stored in ACNUC7421 zone)

EMBL: AP010803.PE11

AP010803.PE11        Location/Qualifiers
FT   CDS_pept        6743..7237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00110"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94845"
FT                   /db_xref="GOA:D4YWW3"
FT                   /db_xref="InterPro:IPR009394"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWW3"
FT                   /protein_id="BAI94845.1"
FT                   /translation="MESDLSDSCSPLTDGTALAVARGTLRLFFRHDMSGILEVPLPNGR
FT                   RADIMALDGAGRITIVEIKCSRADLLGDMKWPDYFDYCDRYFWAVPSGFDLSLFESEAL
FT                   WPGRTGLIVADRYDAELVRPAPMEPLAAARRKAETLRFARRAARRLTALADPDHAAELG
FT                   W"
     atggagtccg atctttccga cagttgttcg cccctgaccg acggcacggc gctggccgtg        60
     gcgcggggta cgctgcgcct gttcttccgc cacgacatga gcgggatatt ggaagtgccg       120
     ctgcccaacg gccggcgcgc cgacatcatg gcgctggacg gggccgggcg gatcaccatc       180
     gtggagatca agtgcagtcg cgccgacctg ctgggcgaca tgaaatggcc ggattatttc       240
     gactattgcg accgttattt ctgggccgtg ccctccggct tcgacctgtc gctgttcgaa       300
     agcgaggcgc tatggccggg gcggacggga ctgatcgtcg cggaccgata tgacgccgaa       360
     ctggtgcgtc cggcgccaat ggagccgctg gcggcggcgc ggcgcaaggc ggaaacgctg       420
     cgcttcgccc gacgggccgc gcgacggctg acggcgctgg ccgacccgga ccatgccgcg       480
     gaactgggct ggtag                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page