(data stored in ACNUC7421 zone)

EMBL: AP010803.PE112

AP010803.PE112       Location/Qualifiers
FT   CDS_pept        110710..110997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01120"
FT                   /product="BolA-like protein"
FT                   /note="stress-induced morphogen (activity unknown)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94946"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX64"
FT                   /protein_id="BAI94946.1"
FT                   /translation="MTEILKGPVATEIEARLRAALAPERLAVIDDSEKHRGHAGHDGSG
FT                   ESHFTVDIVSDRFAGRNRVARQRLVNAALADLLRDKVHALAIKARAPGEA"
     atgaccgaga ttctgaaagg ccctgtcgcc accgaaatcg aagcccggct gcgcgccgcc        60
     ctggcccccg aacggctcgc cgtgatcgac gacagcgaga agcatcgcgg ccatgccggg       120
     catgacggat cgggcgaaag ccacttcacc gtggacatcg tgtccgaccg cttcgccggc       180
     cggaaccggg tcgcccgcca gcgcctggtc aacgccgcgc tggccgacct gctgcgcgac       240
     aaggtccacg ccctggcgat caaggcccgc gcccccggcg aagcgtaa                    288
//

If you have problems or comments...

PBIL Back to PBIL home page