(data stored in ACNUC7421 zone)

EMBL: AP010803.PE114

AP010803.PE114       Location/Qualifiers
FT   CDS_pept        111750..112673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01140"
FT                   /product="pirin-related protein"
FT                   /note="pirin (iron-binding nuclear protein)-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94948"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX66"
FT                   /protein_id="BAI94948.1"
FT                   /translation="MTPPESIIQNDPIIQTITPTSHNLGDFRVHRSLPAKERTMVGPFI
FT                   FFDQAGPARIAPGQGVDVRPHPHINLATVTYMYEGSFLHRDSLGTEQLIEPGAVNLMTA
FT                   GKGIVHSERSPDEDRAKLSKLSAIQTWLALPDRYEEMDPAFEHVGEGGLPVIDGGHARA
FT                   RVIMGSLWGQTSPVTTYANTIYADIQLAPGGSVPIDADAEERAIYVSGGDAALDGVMLQ
FT                   PQTLYVLRPGIRATLMSVDGGRAILCGGEAFRTPRHVWWNFVSSTTDRLMQAREDWEAM
FT                   RFPLIPGDDREFIPIPQGRPKTVSYP"
     atgaccccgc ccgaatccat catccagaac gatccgatca tccagacgat cacgccgacc        60
     agccataatc tgggcgattt ccgggtccat cgctccctgc cggcgaagga acgcaccatg       120
     gtcggcccct tcatcttctt cgaccaggcc ggtcccgccc ggatcgcgcc gggacagggc       180
     gtcgacgtgc gcccgcaccc gcatatcaac ctcgccaccg tcacctatat gtatgagggc       240
     agcttccttc accgcgactc cctgggcacg gagcagttga tcgagccggg cgcggtgaac       300
     ctgatgacgg cgggcaaggg catcgtccat agcgagcggt cgccggacga ggaccgggcg       360
     aaactgtcga agctctccgc catacagacc tggctggcgc tgcccgaccg ttatgaggag       420
     atggacccgg ccttcgaaca tgtcggcgag ggcggcctgc cggtcatcga cggcggccat       480
     gcgcgggctc gcgtgatcat gggcagcctc tggggccaga cctcgcccgt caccacatat       540
     gcgaacacca tctatgccga catccagctt gcccccggcg gatcggtccc catcgacgcg       600
     gatgcggagg agcgggcgat atacgtctcc ggcggcgacg cggcgctgga cggcgtgatg       660
     ctccagccgc agacgctcta cgtcctgcgg cccggcatca gggcgacgtt gatgagcgtg       720
     gacggcggcc gtgcgatact ctgcggggga gaggcgttcc ggacgcctcg ccatgtctgg       780
     tggaatttcg tgtcctccac caccgaccgc ctgatgcagg cccgcgagga ttgggaagcc       840
     atgcgctttc cgctgatccc cggcgacgac cgggaattca tcccgatccc ccaggggcga       900
     ccgaagacgg tgagctatcc ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page