(data stored in SCRATCH zone)

EMBL: AP010803.PE115

AP010803.PE115       Location/Qualifiers
FT   CDS_pept        complement(112796..113626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94949"
FT                   /db_xref="GOA:D4YX67"
FT                   /db_xref="InterPro:IPR011723"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX67"
FT                   /protein_id="BAI94949.1"
FT                   /translation="MILVCPNCATRYIVPDSAVGPNGRQVRCAACKHSWFQEGAALAPR
FT                   EEALATSGMPEVAAPPPPPAPPPPPPPPPPVEEPAAPTVEPVAAPEESEPVAQAASPEA
FT                   ARPDYRFDDVYGRAEADARDDWVEPEPATAKPRRNRLKIWTYAALAFCLAVGAAGGALW
FT                   YFGAPGWAVNLGLVPEEGDPDLLFYLSKPAERRKLPTGEEYFAFGARIVNSGKQVLPVP
FT                   PVLVQLRDRQNRLVFSWTTKADRTSLKPGEEASINESRIDIPKNAENLSLTFVQ"
     atgatcctgg tgtgtcccaa ttgcgccacg cgctatatcg tgccggacag cgccgtcggc        60
     ccgaacggcc gccaggttcg ctgcgccgcc tgcaagcata gctggttcca ggagggcgcc       120
     gcgctcgccc cgcgggagga agcgctggcg acttccggca tgcccgaagt cgcggcaccg       180
     ccgcctcccc ccgcgccacc ccctccgccg ccgcctcccc ctccagtcga ggaacctgcc       240
     gcgccgacgg tcgagccggt cgcggcgccc gaggagtccg agccggtcgc gcaggccgca       300
     tccccggaag cggccaggcc ggactatcgt ttcgacgatg tctacgggcg cgccgaagcg       360
     gatgcgcgcg acgattgggt cgaacccgaa ccggccaccg cgaagccgcg ccgcaaccgg       420
     ctgaagatct ggacctatgc cgcgctcgcc ttctgcctgg ccgtcggcgc agccggcgga       480
     gcgctctggt atttcggcgc gcctggctgg gcagtcaatc tgggactggt gccggaggaa       540
     ggcgatcccg acctgctctt ttatctctcc aagcccgccg agcggcgcaa gctgccgacc       600
     ggggaggaat atttcgcctt cggcgcccgg atcgtgaaca gcggcaagca ggtgctgccc       660
     gtgccgcccg tattggtgca gttgcgcgac cggcagaacc ggctggtgtt cagttggacc       720
     accaaggcgg accggaccag cctgaaaccg ggggaggaag cgtcgatcaa cgaaagccgg       780
     atcgacatcc cgaaaaatgc cgagaatctg tcgctgacct tcgtgcagtg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page