(data stored in ACNUC7421 zone)

EMBL: AP010803.PE118

AP010803.PE118       Location/Qualifiers
FT   CDS_pept        115428..115958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01180"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94952"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX70"
FT                   /protein_id="BAI94952.1"
FT                   /translation="MIVRFIAVTLLGWMLGFAWFAIFLPQPLDGRQTDAIVVLTGGAGR
FT                   IDRGLALLQDGAAKRMLISGVDRSVRPVELAAQYKVPERLFSCCITLGREAIDTRSNAI
FT                   ETAHWLERRDFKTVRLITTDWHMRRSALELRQALPERVTLVYDAVPSRPSLTMLAREYN
FT                   KYLLRRAAALIGI"
     gtgatcgtcc gcttcatcgc cgtcacgctg ctggggtgga tgctgggctt cgcctggttc        60
     gcgattttcc tgccgcagcc gctggacggc cgccagaccg acgccatcgt cgtgctgacc       120
     ggcggggcgg ggcgcatcga tcgcggcctt gccctgcttc aggacggcgc ggccaagcgg       180
     atgctgatct ccggcgtgga ccgctcggtc cgcccggtgg agctggccgc gcaatataag       240
     gtgcctgaac gcctcttctc ctgctgcatc acgcttggcc gcgaggccat cgacacccgc       300
     tccaacgcca tagagaccgc gcactggctg gaacgccgcg atttcaagac ggtgcgcctc       360
     atcaccaccg actggcacat gcgccggtcc gcgctcgaac tgcggcaggc cttgcccgaa       420
     cgggtcacgc tggtctacga cgccgtgccc agccgcccca gcctcaccat gctggcgcgg       480
     gaatataata aatatctgct gcgccgggcg gcggcgctta ttggtatctg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page