(data stored in ACNUC7421 zone)

EMBL: AP010803.PE126

AP010803.PE126       Location/Qualifiers
FT   CDS_pept        complement(125710..126531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01260"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94960"
FT                   /db_xref="GOA:D4YX78"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX78"
FT                   /protein_id="BAI94960.1"
FT                   /translation="MVGQAGGDATGVAVVTGASSGIGAVYADRLAARGHDLLLVARRAD
FT                   RLRQLAQELSDRHGVQVQTATADLAEPESLARVEALVRESNAVLLVNNAGAGGLGPTAA
FT                   ISADRVENVVRLNITALSRLSHAVLEGFRSRGAGTLVNIGSIIALSPSPSAAAYSGSKA
FT                   YVLNFTRSLQAEYADTAIRIQLVQPGPIRTEFFTAAGVSESVFPEDSYLTAEQLVDAAL
FT                   AGLDAGELVTTPTVAETGIWEALEAARLAFMEAARSGQVAERYRVGEESLA"
     atggtcggac aagcgggtgg cgatgcgaca ggcgtagcgg ttgtaaccgg cgcctcttcg        60
     ggaataggag cggtctatgc cgatcggctg gcggcgcgcg gccatgacct gctgctcgtg       120
     gcgcgccgcg ccgaccggct gaggcagtta gcgcaggaat tgagcgaccg ccacggcgtg       180
     caggtccaga cggcgacggc ggacctggcg gagccggaaa gccttgcccg ggtcgaggcg       240
     ctggtccgcg aatcaaacgc cgtcctgctg gtcaacaatg ccggcgccgg cgggctgggg       300
     ccgacggccg ccatatccgc cgaccgggtg gagaatgtcg tgcggctgaa catcacggcg       360
     ctctcgcgcc tgtcgcatgc ggtgctggag ggcttccgtt cgcgcggcgc gggcacgctg       420
     gtcaatatcg gatcgatcat cgcgctgagc ccgtctccaa gcgccgccgc ctatagcgga       480
     tcgaaggcct atgtgcttaa tttcacccga tcgcttcagg ccgaatatgc cgacaccgca       540
     attcggatac agttggtcca gcctggtcct atccgcaccg aattctttac ggccgccggc       600
     gtcagcgaaa gcgtatttcc cgaagattcc tatctgaccg ccgaacaact ggtcgatgca       660
     gcacttgccg gtctggatgc gggcgaactg gtcaccacgc cgacggtcgc ggagaccggc       720
     atatgggaag cgcttgaggc ggcccggctc gcattcatgg aagccgcgcg gtccgggcag       780
     gtcgcggaac gctatagagt gggcgaggaa agtctggctt aa                          822
//

If you have problems or comments...

PBIL Back to PBIL home page