(data stored in ACNUC7421 zone)

EMBL: AP010803.PE129

AP010803.PE129       Location/Qualifiers
FT   CDS_pept        complement(128877..131390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01290"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94963"
FT                   /db_xref="GOA:D4YX81"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX81"
FT                   /protein_id="BAI94963.1"
FT                   /translation="MPKKKRYAALLARLMATGAALSIGGIGMAAHAQIAAASAEADAGE
FT                   AIVVTGLRGLSSKTAVESPAPIDIVPADRLTGTGRQEIGEALARTLPSINFGRTGAGVA
FT                   SIVRPIFNRSLPPAYTLILVDGKRRHNSALLTNGGGDTSGFGPVDLDFIPIAGVRSVEV
FT                   LKDSAAAQYGSDAVAGVINFVLNDRPQPNHVSVTYGDHYKSYGDPWSAKAEGGLGFGLG
FT                   DGGYVNLSGDLRGRGMSWRGFRATNRLLYAPASNPKNAAWDGIGAHNGDPRIRAFNLGL
FT                   DAALPAGDVTLYTQATFGRRKAEIGNMIRRPSGTASFSTVFPDGYFPVNNTSETDFQFL
FT                   AGIRGDLSGWQWDFSSSYGRNQVRMYSDLTLNPSLGPTGPTSFDNLARFRFSQWTNNLD
FT                   VSRDIDIGLAKPLHVQWGLEARREVFQTFAGDPLGYANGGYVIKAGDQEGNPNVGSIAS
FT                   IGAQGAITISPATTAHVSRNVFAGYIDLGLTITPRWYVDIAGRAEHYGLGAGSTVGGKV
FT                   NSRYELSSWLAVRGTVGTGFRAPSLSQIGYAQTDNRTAISPATGLLVAATTQTAPTTSA
FT                   LATALGAATLKPEKTWNAGLGIALQPTRNLSLTIDGYQIDIDDRIARTASLSGPALNAI
FT                   FAANGLPPGTFVQYFANAADTRTRGVDIVGNYTADLSTLGQLSLSAAYSYSRTKIRHVA
FT                   ATPAALVGLGPNPGGSLVAFGNVFRGEIADNQPRSKLALASKWSLDPVSVDLRVTRYGR
FT                   YRYLRTENPAQNLSYGGRWITDLEVSLALTSRLGVAVGAANLFSVRPDNSGVNEPTSGV
FT                   TLFNYGSPPFDSSGGFYYGRINWTF"
     atgccgaaga aaaaaagata tgcagcgctg ctggctcgac tcatggctac cggcgcagcg        60
     ctctccattg gcgggatcgg catggcggcg catgcgcaaa tcgccgctgc atccgccgaa       120
     gcggacgctg gcgaagccat cgtcgtcacc ggattgcggg gtctgtcgtc aaagacggcg       180
     gtggagagtc cggcgccgat cgatatcgtc ccggctgacc gactgaccgg aaccggccga       240
     caggaaattg gcgaggcgct ggcgcggacg ttgccgtcca tcaatttcgg gcgcacgggc       300
     gcgggtgtgg cgtcgatcgt tcggccgatc ttcaaccgca gcctgccgcc tgcctatacg       360
     ctgatccttg tcgacggaaa gcggcgccac aacagtgcgc tgttgaccaa cgggggcgga       420
     gataccagcg gcttcggccc ggtcgacctc gatttcattc cgatcgcagg ggttcgttcg       480
     gtcgaggtgc tcaaggacag cgccgccgcc caatatgggt ccgacgccgt ggccggcgtc       540
     atcaacttcg tgctgaatga ccggccccag ccgaaccatg tctcagtgac ctatggcgac       600
     cactacaaga gctatggcga tccgtggagc gcaaaggccg aaggcggcct gggcttcggg       660
     ctgggcgatg gcggctatgt caacctgagc ggcgatctgc gcggacgcgg catgtcatgg       720
     cgcggtttcc gggcgaccaa ccgcctgctg tacgcaccgg cttccaatcc gaagaacgcc       780
     gcctgggacg gcatcggcgc gcataatggc gacccgcgca ttcgcgcctt caacctgggg       840
     ctggatgccg cgctgccggc cggggacgtc actctctata cccaggcgac attcgggcga       900
     cgcaaggccg agatcggcaa catgatccgc cgtcccagcg gcaccgcatc cttttccacg       960
     gtctttcccg atggctattt cccggtcaac aacaccagcg agacggactt tcagtttctg      1020
     gccggcatca ggggcgatct gtcgggctgg caatgggatt tcagttccag ctacgggcgc      1080
     aatcaggtgc gcatgtacag cgacctgact ctcaatccgt cgctcgggcc gaccgggccg      1140
     accagcttcg acaatctcgc gcggttccgt ttttcgcagt ggaccaacaa tctcgatgtg      1200
     tcccgcgata tcgatatcgg cctggcgaag ccactgcacg tccagtgggg gcttgaggcg      1260
     cggcgcgagg ttttccagac ctttgccggc gatccgctgg gctatgccaa tggcggatat      1320
     gtcatcaagg ccggcgacca ggaaggcaac cccaatgtcg gaagcatcgc gtcgatcggc      1380
     gcgcaggggg cgatcaccat ttcccccgcg acgaccgccc atgtctcgcg caacgtcttt      1440
     gcgggctata tcgacctggg cctgacgatc acgccgcgct ggtatgtcga catcgccgga      1500
     cgcgccgaac attatgggct gggcgcggga tcgacggtcg gcggcaaggt caacagccgg      1560
     tatgaattat cgtcctggct cgctgttcgc ggcacggtgg gcaccggctt ccgcgcgccc      1620
     tcgctctcgc agatcggcta tgcccagact gacaaccgca cggcgatcag ccccgcgacc      1680
     ggcctcctgg tcgcggcgac gacgcaaacc gcgccgacca cctcggcatt ggcgaccgct      1740
     ttgggcgccg ccaccctgaa gcctgaaaaa acctggaatg ccgggctcgg catcgccctt      1800
     cagccaacgc gcaacctgtc gctgacgatt gacggatacc agatcgacat cgatgatcgg      1860
     atcgcccgca ccgccagcct gagcggccct gctctcaacg ccatcttcgc ggcgaacggt      1920
     ctcccgcccg gcacattcgt ccaatatttc gccaacgccg ccgacacccg cacgaggggc      1980
     gtcgatatcg tcggcaatta taccgccgac ctgtcgaccc tggggcaatt gtcgctgtcg      2040
     gccgcctatt cctacagccg cacgaagatc cggcatgtgg cggcgactcc ggcggcgctc      2100
     gtcggcctcg gccccaaccc cggcggaagc ctggtggcgt tcgggaacgt atttcggggc      2160
     gaaatcgccg acaaccagcc acgatccaag ctcgcgctcg ccagcaaatg gtcgctcgac      2220
     ccggtgtcgg tcgatctgcg ggtgacgcgc tatggccgat atcgttatct gcgaacggaa      2280
     aatccggcgc agaatctcag ctatggcgga cgctggatca ccgatctcga agtctccctc      2340
     gcgctgacat cgcgcctggg cgtcgctgtg ggcgccgcca acctgttcag cgtgcgcccc      2400
     gacaatagcg gggtgaatga gccaacgagc ggcgtgacgc tgttcaacta cggcagcccg      2460
     ccgttcgatt cttcgggcgg cttctattac gggcggatca actggacgtt ctga            2514
//

If you have problems or comments...

PBIL Back to PBIL home page