(data stored in ACNUC7421 zone)

EMBL: AP010803.PE13

AP010803.PE13        Location/Qualifiers
FT   CDS_pept        7854..8600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00130"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative enzyme with a TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94847"
FT                   /db_xref="GOA:D4YWW5"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWW5"
FT                   /protein_id="BAI94847.1"
FT                   /translation="MTTDSIEAADRLAANRLAGIRAAMGRTASLTGRTADDITLIAVSK
FT                   TQAADAIRPLIAAGQRVFGENRVQEAESKWPALRDEHDGLQLHLVGQLQSNKAADAVAL
FT                   FDVIHSLDRPSLLTALARAMDAADRRVPCFVQVNIGAEPQKGGCPIADVPALIRSAREA
FT                   GIPLLGLMCVPPADIEPAPFFALLAKMAREEGLEGLSMGMSGDYETAIMLGATHIRVGT
FT                   ALFGERPAARPTPGSGRGMIRNSRAK"
     atgacgaccg acagcatcga agccgcagac cggctggccg cgaacagatt ggccgggata        60
     cgcgccgcca tgggccgcac cgccagcctg accggccgca ccgccgacga catcaccctg       120
     atcgccgtgt cgaagacgca ggcggcggac gccatccgtc cgctgatcgc ggcgggccag       180
     cgggtcttcg gcgagaaccg cgtgcaggaa gcggaaagca aatggcctgc cctgcgggat       240
     gagcatgatg gccttcaact gcatctggtc ggtcagctcc agtcgaacaa ggcggccgat       300
     gcggtcgcgc tgttcgacgt cattcattcg ctcgaccgcc cgtcgctgct gacggcgctt       360
     gccagggcga tggatgcggc ggacaggcgc gtgccctgct tcgttcaggt caatatcggc       420
     gcggaaccgc aaaagggcgg ctgtccgatc gcggatgtgc ccgcgctgat ccgctcggcg       480
     cgtgaggcgg gcattccgct gctgggcctg atgtgcgtgc cgccggccga catcgaaccc       540
     gcgcccttct tcgcgctgct cgccaagatg gcgcgcgaag aggggttgga gggactctcc       600
     atgggcatgt cgggggacta tgaaaccgcg atcatgttgg gcgctacgca catccgcgtc       660
     ggcacggccc tgttcgggga gcgccctgcc gcccgcccga cgccggggag cggcaggggc       720
     atgatcagaa actcccgcgc aaagtga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page