(data stored in ACNUC7421 zone)

EMBL: AP010803.PE132

AP010803.PE132       Location/Qualifiers
FT   CDS_pept        complement(134298..136691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01320"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94966"
FT                   /db_xref="GOA:D4YX84"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX84"
FT                   /protein_id="BAI94966.1"
FT                   /translation="MSIRHTASPLALAIILAATSPQTQAAEREAAADMAAVDAVDSADA
FT                   GSAIIITARRRNEKIQDVPVAANSYGGEQIEATRTYNLRDLQALSPSLVVTVTNPRNTS
FT                   INIRGLGNNVSVYNDGLEPAVGVYMDQVYLARPGQAVFDLADIERIEVLRGPQGTLFGK
FT                   NTSAGAVVITTKSPTFEPEIGGDLTYGNYDFRQLHAYASGALIDDKLAARIYVSKTDRD
FT                   GYVTNRYDDSRTQDYHDFGLRGQLLFTPTDNFKLRLIGDYGFQKQRTAAAVLTGVIRTY
FT                   DNGGNFANNYTDRTARLGVPVVADAPGERIVDMDGNPRYKMRQGGVSAIADLALPGHSL
FT                   TSVTSWRRWDWYPHNDGDSTRLDAGRDFHQSNNQQQFSQELRIASEGERKVDYIAGLYY
FT                   LWQSIKAEALNAYGADAAPWFLAPTVDPAVGAAALNNYTVLSHSKPVTNSYAAFGQTIW
FT                   HVTPTIDLTTGLRYTYETKSGWFDQEATGADLSGLTTAQQAAAQAIRARYGVANHYEAK
FT                   TKEGRLSGQATLSWKVTPDALLYATYGRGNKFGGLNLANIVTTGQFAVDPVIKPETIDS
FT                   YELGLKTSWSGGKLTVNLAGFWTDVSDYQTTIVDTAPDRNNISYFTNVGKVRTRGFEGD
FT                   IRLVPAAWLSLYGSGTYTDAQYVSYPNAPCPIETTGIVSCNLSGDRLPGVSKWAFSAGG
FT                   EAKAAIGNRLGHEAEVYAGADFSYRSNFYTTASLSRYSLIPGYSLLNARIGVRALDGAL
FT                   DLQLWGRNLFDKDYFQSLSAANTGAITGTLGDPRTYGVTLRTRF"
     atgtctatcc gtcacactgc atctccgctt gccctcgcca tcattcttgc cgcaacatcg        60
     ccgcagaccc aggcggcgga gcgcgaagcc gccgccgaca tggcagccgt cgacgctgtc       120
     gattccgctg atgccggcag cgcaatcatc atcaccgccc ggcgccggaa cgagaaaatc       180
     caggacgtgc ccgtcgccgc gaacagctat ggcggcgagc agatcgaagc tacgcggacc       240
     tacaatctgc gcgatcttca ggccctcagt cccagcctcg tggtgacggt caccaatccg       300
     cgcaacacca gcatcaacat ccgcggcctc ggcaacaatg tctccgttta caatgacggg       360
     ctggagccgg cggtcggcgt ctacatggac caggtctatc tcgcccggcc cggccaggcg       420
     gtcttcgatc tcgccgacat tgagcggatc gaggttctgc gtggtccgca gggcaccctc       480
     ttcggcaaga atacatcggc gggcgcggtc gtcatcacca ccaaatcacc gactttcgag       540
     ccggagatcg gcggcgatct gacctatggc aattatgatt tccgccagtt gcacgcctat       600
     gcgagcggcg cgctgatcga cgacaagctt gcggcccgca tctatgtctc caagacggat       660
     cgggacggct atgtcaccaa tcgctatgac gacagcagga cacaggatta tcatgatttc       720
     ggcctgcgcg gacagttgct gttcacgccg accgacaatt tcaagctgcg gctgatcggc       780
     gactatggct tccagaaaca gcggactgcg gcggccgtct tgaccggcgt catccgcacc       840
     tatgacaatg gcggcaattt cgcgaacaac tataccgatc ggactgcccg gctcggcgtg       900
     ccggtcgttg ccgatgcgcc gggcgagcgc atcgtcgata tggatggcaa tccccgatac       960
     aagatgcgcc agggcggcgt gtccgccatc gcggacctcg ccctgccggg acattccctg      1020
     acctccgtca cttcctggcg tcggtgggac tggtatccgc acaatgatgg cgacagcacc      1080
     cgtctggatg caggtcggga ttttcaccag agcaacaacc agcagcagtt cagtcaggag      1140
     ttgcgcatcg cttccgaggg cgagcgcaaa gtcgattata tcgccggcct ctattatctg      1200
     tggcagtcga tcaaggcgga agcgctcaat gcctatggcg cggacgcggc tccctggttc      1260
     ctggcgccca cggtcgatcc ggctgtcggg gcggcggcac tcaacaacta caccgttctc      1320
     agccattcga aacccgtgac gaacagctac gccgcattcg gccagacgat ctggcatgtc      1380
     acgccgacga tcgacctcac caccggcctg cgctacacct atgaaaccaa gagcggctgg      1440
     ttcgatcagg aggcgacggg cgccgatctg agcggtttga cgaccgcgca gcaggctgcc      1500
     gcgcaggcga tccgcgcgcg atacggcgtc gccaaccatt atgaggcgaa gacgaaggaa      1560
     ggccgcttgt cgggtcaggc gacgctgtcc tggaaggtga cgccggacgc attgctctac      1620
     gccacctatg gacgtggaaa caagttcggc gggctgaacc ttgccaatat cgtcacgacc      1680
     ggccagttcg ccgtcgatcc ggtcatcaag ccggaaacca tcgacagcta tgaactggga      1740
     ttgaagacca gttggtcggg cggcaagctt acggtgaacc ttgccggctt ctggaccgac      1800
     gtcagcgatt atcagacgac gatcgtcgat accgctccgg atcgcaacaa catctcctac      1860
     ttcaccaatg tgggcaaggt gcgcacgcgc gggttcgagg gagacattcg cctcgtcccc      1920
     gccgcatggc tctcgctcta tggctcaggc acctataccg acgcgcaata tgtgagctat      1980
     cccaacgcac cttgtccgat cgagacgacg ggcatcgtgt cctgcaatct gtcgggcgac      2040
     agattgccgg gcgtatcgaa atgggccttc tccgccggcg gcgaggccaa ggctgcaatc      2100
     ggcaatcgcc tgggacatga ggcggaggtc tatgccggcg ctgatttcag ctatcgctcc      2160
     aacttctaca cgacggcgag cctgtcgcgc tattcgctga ttcccggcta cagcctgctc      2220
     aacgcgcgca tcggcgtacg agctttggat ggagcgctgg acctgcagtt gtggggccgc      2280
     aacctcttcg acaaggatta tttccagagc ctgtcagccg ccaataccgg ggcgatcacc      2340
     ggcacattgg gggatccgcg aacctatggc gtgactctcc ggacgcgttt ctag            2394
//

If you have problems or comments...

PBIL Back to PBIL home page