(data stored in ACNUC7421 zone)

EMBL: AP010803.PE133

AP010803.PE133       Location/Qualifiers
FT   CDS_pept        136875..138620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01330"
FT                   /product="putative arylsulfatase A"
FT                   /EC_number="3.1.6.8"
FT                   /note="arylsulfatase A or related enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94967"
FT                   /db_xref="GOA:D4YX85"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX85"
FT                   /protein_id="BAI94967.1"
FT                   /translation="MNKMLKLSAFLTATALAGVAAPVVRAAPAADPVAAPGATQRQPNF
FT                   LVIVADDLGWSDLGAFGGEIQTPNLDAIANAGVRFTGFHTAPTCSPTRSMLLSGVDNHQ
FT                   AGVGSMAETLQPNQIGQPGYEGYLNDRVASIAELLHQGGYRTLMSGKWHLGLTPERGPA
FT                   ARGFERSYALLQGLGNHFGADQNKAWAAIGGASTYRDNGRIVKYPKGRYSADYFTDRLI
FT                   GFLEEGAKDQRPFFAYLPYTTPHWPMQAPAETIAKYKGRYDAGYEALRDARLARQKQLG
FT                   LVPVDLKPHDWEGVKPWASLSADEKAIEARKMEVYAAMVDRMDQNVGRVVEVLKKLGRY
FT                   DDTVIIFLADNGPEGNVIEAPFQAALKPDKLPALRIDNSLDNIGKASSYVGYGPGWAQA
FT                   NSSPSWLVKSYPTEGGTRVTAFAAGRGVAGRRIAGGLFSVTDVAPTLLDLAGLQQPATF
FT                   AGHAILPFQGHSLAPVLTGGQAEVRQPTEAVGTELFYRRALRKGDWKAVYLPTSSSAYP
FT                   RNSVGTGVWQLFNVAQDPAEAHDLAAAEPAKLKELVADWDSYAKDKGVVLPPPEAAKPE
FT                   GAAKP"
     atgaataaga tgttgaaatt atctgccttt ctgacggcga ccgcacttgc gggcgtcgct        60
     gcgccggtgg tgcgggctgc gccggcggcc gatcccgttg ctgcgccggg tgcgactcag       120
     cgtcagccaa acttccttgt catcgtcgcc gacgaccttg gctggtccga tctgggagcc       180
     ttcggcggcg agattcaaac ccccaatctg gacgccatcg ccaatgccgg ggtgcgcttc       240
     accggcttcc acaccgcgcc gacctgctcg cccacccgct ccatgctgct gagcggcgtc       300
     gacaatcacc aggccggcgt gggttcgatg gccgaaaccc ttcagcccaa ccagatcggc       360
     cagcccggct atgaaggcta tctcaacgac cgggtcgcct ctatcgccga actgctgcat       420
     cagggcggct atcgcacgct catgtccggc aaatggcatc tgggcctgac gcccgagcgc       480
     ggcccggccg cgcgcgggtt cgagcgttcc tatgcgttgc tccaggggct gggcaatcat       540
     ttcggcgccg accagaacaa ggcctgggcg gcgatcggcg gcgcatccac ctatcgcgac       600
     aatggcagga tcgtgaaata tcccaaggga cgttattcgg ccgattattt caccgaccgg       660
     ctgatcggct tcctggagga aggcgcgaag gaccagcggc ccttcttcgc ctatctgccc       720
     tacaccacgc cgcactggcc gatgcaggcg ccggcggaaa cgatcgccaa atataagggc       780
     cgctatgacg ctggctatga agcattgcgc gacgcgcggc tggcgcggca gaagcaattg       840
     ggcctcgtcc ccgtcgacct gaaaccgcac gactgggagg gagtgaagcc ctgggcctcg       900
     ctcagcgccg acgaaaaggc catcgaggcg cgcaagatgg aagtctatgc cgcgatggtc       960
     gatcgcatgg accagaatgt cggccgcgtg gtggaggtgc tcaagaagct gggccgctat      1020
     gacgatacgg tcatcatctt cctcgccgac aacgggccgg agggcaatgt gatcgaggca      1080
     cccttccaag cggcgctgaa gcccgacaag ctgcccgcgc tcaggatcga caacagcctc      1140
     gacaatatcg gcaaggcttc ctcctatgtc ggctatggcc ccggctgggc gcaggcgaac      1200
     agttcgccgt cctggctggt gaagagctat ccgaccgagg gcggcacccg cgtcaccgct      1260
     ttcgctgccg ggcgcggcgt cgcagggcgg cggatcgcgg gcggtctgtt cagcgtcacg      1320
     gacgtcgcgc cgaccctgct ggacctcgcc gggctgcaac agcccgcgac cttcgccggc      1380
     cacgcgatcc tgcccttcca ggggcatagc ctggcgccgg tgctgaccgg cgggcaggcg      1440
     gaagtgcgcc agccgaccga agcggtcggg accgaacttt tctaccgccg cgcgctgcgc      1500
     aagggcgact ggaaggcggt ctatctgccg acgtcgagca gcgcctatcc gcgcaacagc      1560
     gtcggcaccg gcgtctggca attgttcaac gttgcccagg atccggccga agcccatgat      1620
     ctggcagcgg ccgaaccagc gaaactcaag gagctggtcg ccgactggga cagctatgcc      1680
     aaggacaagg gcgtggtcct gccaccgccc gaagccgcca agccggaagg cgcggcaaag      1740
     ccatga                                                                 1746
//

If you have problems or comments...

PBIL Back to PBIL home page