(data stored in ACNUC7421 zone)

EMBL: AP010803.PE134

AP010803.PE134       Location/Qualifiers
FT   CDS_pept        138617..139498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01340"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94968"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX86"
FT                   /protein_id="BAI94968.1"
FT                   /translation="MSHGRRHAGAFAACAIALLGAAPPPAASPGPRCDARDGRVLVPAG
FT                   TVLLGEDGDGRPGQAVAVPAFWIDRHEVTNRQFAAFVAATGYRTAAEQEGGSAVFVQPT
FT                   GPVDLNNAGNWWRYRQRADWRHPDGPGSDIAGREDWPVVHVNYQDAAAYARWAGAALPD
FT                   EAQWERAARGDQSGPRDPRSWAYDGEGHPTANSWQGVFPVRDTGQDGHVGLAPVGCFDG
FT                   NGFGLHDMVGNVWEWTSERRGGNGLIKGGSYLCAMNYCANFRPAAFQAQELDLGTSHIG
FT                   FRTIATEPDPSS"
     atgagccatg gacggcggca tgcgggagca ttcgcggcct gcgcgattgc gctgctgggc        60
     gccgcgccgc cgcctgccgc cagtcccggc ccacgctgcg acgcgcgcga cggccgcgtg       120
     ctggtgcccg ccgggacggt gctgctgggc gaggatggag atgggcggcc gggccaggcg       180
     gtcgccgtcc ccgccttctg gatcgaccgg catgaagtga ccaatcgcca gttcgccgcc       240
     ttcgtcgccg ccaccggcta tcgcaccgcc gctgagcagg aaggggggtc ggccgtcttc       300
     gtccagccga ccggcccggt ggacctcaac aatgccggca attggtggcg ctatcggcag       360
     cgggcggact ggcgccatcc cgacggcccc ggcagcgaca ttgcgggccg ggaggactgg       420
     cccgtcgtcc acgtcaatta ccaggatgcc gccgcctatg cccgttgggc cggggcggcc       480
     ctgccggatg aagcgcaatg ggaaagggcg gcgcggggcg atcagtccgg cccgcgcgat       540
     ccgcgtagct gggcctatga tggcgaaggg catccgaccg ccaatagctg gcagggcgtg       600
     ttcccggtcc gcgataccgg ccaggacggc catgtcggct tggcgccggt cggctgcttt       660
     gatggtaacg gcttcggcct gcacgacatg gtcggcaatg tctgggaatg gaccagcgaa       720
     aggcgcggcg gcaacggact gatcaagggc ggctcctatc tctgcgcgat gaactattgc       780
     gccaatttca ggcccgccgc tttccaggcc caggaactgg accttggcac gtcccacatc       840
     gggttcagga cgatcgcaac agagccggac ccatcgagct ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page