(data stored in ACNUC7421 zone)

EMBL: AP010803.PE135

AP010803.PE135       Location/Qualifiers
FT   CDS_pept        complement(139620..139889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94969"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX87"
FT                   /protein_id="BAI94969.1"
FT                   /translation="MAILSDRQRQCRRSVLGRIDISEDVEPKMPAFREPERSVARQRGQ
FT                   IRKCREMANFGHCPTVTPDLIRGPAFLSECPPCPRQRDPGSSPG"
     ttggcgatac tctcggatcg gcagcgtcag tgccgtcgat cggtcctggg ccgtatcgac        60
     atttcagaag atgtcgagcc gaaaatgccg gcctttcgcg agccggagcg gagcgtagct       120
     aggcagcgtg gacaaattcg aaaatgtcgt gaaatggcca atttcggtca ttgccccacc       180
     gtcaccccgg acttgatccg gggtcccgct ttcttgtctg agtgcccgcc ttgtccaagg       240
     cagcgggacc ccggatcaag tccggggtga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page