(data stored in ACNUC7421 zone)

EMBL: AP010803.PE136

AP010803.PE136       Location/Qualifiers
FT   CDS_pept        complement(139938..140249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94970"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX88"
FT                   /protein_id="BAI94970.1"
FT                   /translation="MLLHTALLCRPASRTSARTESIAMSHHLRGTSDPRPASATTAKRH
FT                   ESPDWVTFVHRLSLGHIDFRQRPASPTPPFICIYRYSRSPIASSCYFKDLAPTATWSA"
     atgcttttgc acacggccct gctatgtcgg cctgcttccc gcacatctgc caggaccgaa        60
     agcattgcga tgagccatca tctcagagga acttccgatc cgcgccctgc ttcagcaacg       120
     acagccaagc ggcatgagtc cccagattgg gttacctttg ttcaccgcct ctcccttggc       180
     catatcgatt tccggcaacg tccagcatcg cctacccctc cttttatctg tatatacaga       240
     tatagtcgca gtccgatagc gtcaagctgc tattttaagg atcttgcacc tacggcaacc       300
     tggagcgcgt ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page