(data stored in ACNUC7421 zone)

EMBL: AP010803.PE138

AP010803.PE138       Location/Qualifiers
FT   CDS_pept        140604..142982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01380"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94972"
FT                   /db_xref="GOA:D4YX90"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX90"
FT                   /protein_id="BAI94972.1"
FT                   /translation="MSQEAPAQDGQNEGGLQEIIVTAQTRAQKLQEVPISVVAVQGTDL
FT                   ATKAVIRPIDLQIAAPGFTATETAFATQFFIRGIGSGLNAGFEQSVGLYVDGVHLPRSL
FT                   QTRIPFLDVDRVEVLRGPQSILLGKNAIAGALNVTTAKPTQDFFGRLTSSYEFNANELG
FT                   LEGAVSGPITDTIRVRVAGKYRSSDGYIRNLTLNRLEPARDEAAIRVTADIDVTQDLQL
FT                   SFKSEYNQFNTDGKAMEIYGEEPAKAGPFAGLTYAQVLVNVFHLDPTLLDNRIDGRRTS
FT                   DGEKSRAHATANVLTLNWQTGGYTLRSTTAYTTALADDDAINPDLLGARIITGHIRDNY
FT                   TQFSQELRLISPKFDSFDFIAGAYYANGLQRYRQAVGFPSDSTFVTIVNARQPGAGTLV
FT                   ANTWINRRVRVEADTFSAFGQLNWRPISDVTVQLGGRLSYSKIQGSKILTVEPIGGGAL
FT                   PAAQVNAPLVYAQVLAASSSNLAGLGAAGNAMINRLGEFPVAGTRRETRFTPDVKILYR
FT                   PTPQVMLYAGYARGQKSGGFDFAANNRLTYPTARDAFEFDDEKAQNFEVGSKMSLLGGR
FT                   AELNLAAYYTKLTNLQISIFDGRLGFNVGNAASARAQGIEANGRMQLGRHFTLSTGVNY
FT                   TDFKYLRFPNGQCYFGQTPTVDGNGDGVPEFCDYKGKSSQLTSKVTANASLTSVFPIFD
FT                   GYQIGTTTEVFYASAYDAAANYDPAGRQAKYALLNMRVGVGPENGSWELAFVGRNLTDK
FT                   QVFQFVGDTAIAATVAQAKSNYAILSQGRTLAIQLNAKF"
     gtgagccagg aggcgcctgc tcaggacggc cagaatgagg gcgggctgca ggaaatcatc        60
     gtcacggcgc agacccgcgc gcagaagctg caggaggttc cgatctccgt ggtggccgtg       120
     cagggtaccg atcttgcgac gaaagccgtc attcgcccga tcgatcttca gatcgccgcg       180
     cccggcttca ccgccacgga gacggcgttc gcgacgcaat tcttcatccg cggcatcggt       240
     tccggcctga atgccgggtt cgagcagtcg gtcggcctct atgtcgatgg cgtccatctg       300
     ccgcggtcgc tccagacccg cataccgttc ctggacgtgg accgggtcga agtgttgagg       360
     ggaccgcaat ccatcttgct cggcaagaac gccattgccg gggccttgaa cgtgacgacg       420
     gccaaaccca cgcaggattt tttcggccgc ctcacctcgt cttacgagtt caacgccaat       480
     gaattgggtc tggagggagc tgtctccggc cccatcacgg atacgatccg cgtccgcgtg       540
     gccggcaaat atcgcagcag cgacggctat atcaggaacc tgactctcaa ccggctcgaa       600
     ccggcgagag acgaagctgc cattcgcgtg acagcggaca tcgacgtcac ccaagacctc       660
     cagctttcct tcaagagcga atacaaccag ttcaatacag atggcaaagc catggagata       720
     tatggcgagg aacctgcaaa agcggggcct tttgccgggc tcacttatgc ccaggtgctc       780
     gtcaacgtgt tccacctcga tcctacgctt ctcgacaacc ggatcgacgg ccgccggacg       840
     tccgacggcg agaaaagccg ggcccacgcc accgccaacg tcctgacgct gaactggcag       900
     acgggcggat acaccctgcg ttcgaccacg gcctacacga ccgccctcgc ggacgatgac       960
     gcgatcaatc cggatctgct gggggcacgg atcatcaccg gccatatccg cgacaattac      1020
     acgcagttca gccaggaact ccggctgatt tcgcccaaat tcgacagttt cgactttatc      1080
     gcgggcgcct attacgccaa tggcctgcag cgttatcgtc aggccgtcgg gttcccctcg      1140
     gattcgacgt tcgtcacgat cgtgaatgcg cgccagcccg gtgccggcac gctggtggcc      1200
     aatacctgga tcaaccggcg ggtgagggtg gaggcggata ctttctccgc cttcggccag      1260
     ttgaactgga ggccgatatc cgatgttacg gtccagctcg gcggccgtct gagctacagc      1320
     aagatccaag gctcgaagat cctcactgtc gaaccgatag gcggcggagc gcttccggcc      1380
     gcccaggtca atgcgcccct ggtctatgcg caggttctgg cggcgtcgtc ctccaatctc      1440
     gccgggctgg gggcggccgg gaatgcgatg atcaaccgcc tcggcgaatt ccccgtcgcc      1500
     gggacgaggc gggaaacgcg attcacgccc gacgtgaaga tcctgtaccg gccgactccg      1560
     caagtcatgc tttatgcggg ctatgcgcgt ggtcaaaaga gcggcgggtt cgatttcgcc      1620
     gccaacaaca ggttgactta tccgaccgcg cgcgatgcct tcgaatttga cgatgaaaag      1680
     gcacagaatt tcgaggtcgg cagcaagatg tcgctgctcg gaggacgtgc cgaactcaat      1740
     ctcgcagctt attacaccaa gctcacgaac ctgcagatct ccatcttcga cggccgtttg      1800
     ggtttcaatg tcggcaatgc cgcaagcgcg cgggcgcagg ggatcgaggc caatgggcgg      1860
     atgcagttgg gacggcattt tacgctgtcg accggcgtca actatacgga tttcaaatat      1920
     ctccgcttcc ccaatggcca atgctatttc ggacagacgc ccaccgtgga cggcaatggc      1980
     gacggcgtgc cggaattttg cgactataaa ggaaaatcca gccagttgac gtcaaaggtt      2040
     acagccaatg ccagcctgac atcggtcttt ccgatattcg atggctacca gatcggcacg      2100
     acgaccgagg tcttctatgc gagcgcctat gacgcggcgg ccaattacga ccccgccggt      2160
     cggcaggcca aatatgcctt gctcaacatg cgcgtcggag tcggtccgga gaacgggtcc      2220
     tgggaattgg ctttcgtcgg caggaacctt accgacaagc aggttttcca gtttgtcggg      2280
     gacaccgcaa tcgcggccac cgttgcccag gccaagtcga actacgccat cctttcacag      2340
     ggtcggacgc tggccattca attgaacgca aagttctga                             2379
//

If you have problems or comments...

PBIL Back to PBIL home page