(data stored in ACNUC7421 zone)

EMBL: AP010803.PE14

AP010803.PE14        Location/Qualifiers
FT   CDS_pept        complement(8578..11343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00140"
FT                   /product="TonB-dependent receptor-like protein"
FT                   /note="outer membrane receptor proteins, mostly Fe
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94848"
FT                   /db_xref="GOA:D4YWW6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWW6"
FT                   /protein_id="BAI94848.1"
FT                   /translation="MKKSLWLISVGAIALGSSVPVAWAQDSGSAVDSENVNIIVTATRR
FT                   ASPLSDVPIAVSAVTSQAMQNSGATDIRALNQLAPSLLLSSTGTEANASARIRGIGTVG
FT                   DNPGLESSVAVFIDGVYRSRTGAGLNELGEIERVEVLRGPQGTLFGRNASAGLINIISK
FT                   APEFTLGGKAEVTYGNYDYWRLAGRVTGPVTDKLALSLDGVWSKRDGFYDLVNASGAKV
FT                   GETNDRDRYFLRGQALFQPNDALSIRLIGDYTHRDESCCGAPYIETRERRPVAGGGYST
FT                   APFNRIAAILAGQGSVFGADPYDRDLTITAGRNYVSKLKDWGVSGEINYDLGGTKLTSI
FT                   TAYRHYKSQDYGDYDYGGADLLYRDPNTHRQFKTFTQELRAQGSAFNDVLDWLVGGYYA
FT                   HEKLTLEDNIVFGADYGRFAACRLMAGASVNSNLTAAQLAACGSGLATQALITGTQAQL
FT                   NAGLILAGVPALQAGAISTGLGNGLRALAAIPSGTGDVASLYHQKSENWALFTHNIVHI
FT                   TSQLDLTLGLRYTHESKRFSADFNNNNATCAALQASSLPAIATNAQLGSAAALAGGILT
FT                   LGCLGNGSTGLNALDLNDKISDGEFSGTAVLSWKPIQELLVYGSYSKGYKAGGYNLDRF
FT                   QLGSTGLNAVPAVFAPRTNADVTSLRFAAEKVDAFEVGLKYTQPKWSANIAAFRQEFKN
FT                   FQLNTFNGTSFVVQNINGCDGALTAARTCAGGDVGPGLISQGVELELSATPARNVRVAG
FT                   GFTYARAKFANRLVGSSNGTVPLDPALFLLPGSINSQAPEVVTTVSAAWTPSLGSNGLS
FT                   ALFYVDGRMSSDFNTGSDLFPEKRQDGYAVFNARVGIRGPQQRWAVEFWGQNIFNQDYS
FT                   QVAFSTPLQSSSPSTSTTGQFALGAPMANQLISAYLAEPRTYGITLRGSF"
     atgaagaaaa gcctttggct gatttctgtc ggtgccattg cattgggcag cagcgttccg        60
     gtcgcatggg cgcaggacag cggatcagcc gtcgattccg aaaacgtcaa catcatcgta       120
     accgcgaccc gacgcgccag cccgctgtcc gacgtgccga tcgccgtgtc cgccgtgacg       180
     tcgcaggcga tgcagaatag cggcgcgaca gacattcgcg cgctcaacca attggctccc       240
     tcgctgctgc tctcctccac ggggacagag gccaacgcct cggcgcgcat ccgcggcatc       300
     ggcacggtgg gcgacaatcc ggggctggaa agctcggtcg cggtgttcat cgatggcgtt       360
     tatcgctccc gcaccggcgc cggcctcaac gaactgggcg agatcgagcg ggtggaggtg       420
     ctgcgcggcc cccagggcac gctgttcggg cgcaacgcgt ccgccggcct catcaacatc       480
     atcagcaagg cgccggaatt cacgctgggc ggaaaagccg aagtcaccta cggcaattat       540
     gattattggc gtctggcggg ccgcgtcacc gggccggtca ccgacaagct ggcgctcagc       600
     ctggacggcg tctggtcgaa gcgggacggc ttctacgacc tggtgaacgc cagcggcgcc       660
     aaggttgggg aaaccaatga ccgcgaccgt tatttcctgc gcgggcaggc attgttccag       720
     ccgaatgacg cgctctccat ccgtctcatc ggggattata cccatcgcga cgaaagctgc       780
     tgcggcgccc cctatatcga gacgcgggaa cgccgcccgg tcgcgggcgg cggctacagc       840
     acggcgccct tcaaccggat cgccgccatc ctggcggggc aaggcagcgt ctttggcgcc       900
     gatccctatg atcgcgacct caccatcacg gccggccgga attatgtgag caagctcaag       960
     gattggggcg tttcggggga gatcaactat gacctaggcg gcaccaagct gaccagcata      1020
     accgcctatc gccattacaa gagccaggat tatggcgatt acgactatgg cggggccgac      1080
     ctgctctacc gcgatcccaa cacccatcgt cagttcaaga ccttcaccca ggaactcagg      1140
     gcgcagggat cggccttcaa cgatgtgctc gactggctgg tcggcggcta ttatgcgcat      1200
     gaaaagctca cgctggagga taatatcgtc ttcggcgcgg actatggccg ctttgccgcc      1260
     tgtcgcctga tggcgggagc gagcgtcaac agcaatttga cggcggcgca gcttgccgct      1320
     tgtggcagcg ggcttgcgac gcaggcgctg atcaccggca cgcaggcgca gcttaacgcc      1380
     ggcctcatcc ttgccggcgt tccagccttg caggccgggg cgatttccac cggcctgggc      1440
     aacggtctcc gcgcgctggc cgcgatcccg tcgggcaccg gcgacgttgc ctcgctctac      1500
     catcagaaaa gcgagaattg ggcgctgttc acccataata tcgtccacat caccagccag      1560
     ctcgatctga cgctgggcct gcgctacacc catgaaagca agcgtttctc ggccgatttc      1620
     aacaataaca acgccacctg cgcggccttg caagcgtcca gccttcccgc catcgcaacc      1680
     aatgcgcagc tcggcagcgc ggcggccttg gcgggcggaa tcctgaccct gggttgtctc      1740
     ggcaacgggt cgacggggct gaacgcgctc gacctcaacg acaagatcag cgacggggaa      1800
     ttttccggca ccgccgtcct gtcgtggaag ccgatccagg aattgctggt ctatggcagc      1860
     tattcgaagg gctataaggc aggcggctac aatctcgacc gcttccagct cggatcgacg      1920
     ggcctgaacg cggtgccggc cgtgttcgcg ccgcgcacca acgccgacgt gaccagcctg      1980
     cgcttcgccg cggaaaaggt ggacgcgttc gaagtgggcc tgaaatatac ccagcccaaa      2040
     tggagcgcga acatcgccgc cttccggcag gagttcaaga atttccagtt aaacaccttc      2100
     aacggcacca gcttcgtcgt gcaaaacatc aatggctgcg acggggcgct gacggcggcg      2160
     cggacctgcg ctggcggtga tgtgggaccg ggcttgatca gccagggcgt ggaactggaa      2220
     ctgtcggcaa cgccggcgcg gaacgtgcgg gtggccgggg gcttcaccta tgcccgcgcc      2280
     aagttcgcca accgcctggt cggcagcagc aacggaacgg tgccgctcga tccggcgctg      2340
     ttcctgctgc cgggatcgat caactcccag gcgccggaag tcgtgacgac agtcagcgcg      2400
     gcctggacgc cttcgcttgg ttccaacggc ctgtcggcgc tcttctatgt cgatgggcgc      2460
     atgagcagcg acttcaacac cgggtccgac ctgttccccg aaaagcggca ggacggctat      2520
     gcggtgttca acgcccgtgt cggcatccgc ggaccgcagc aacgttgggc ggttgaattc      2580
     tggggccaaa atatcttcaa ccaggactat agccaggtcg ccttcagcac cccgctgcag      2640
     tcgagcagcc cgtccacctc gacaaccggc cagttcgccc tgggcgcacc gatggcgaac      2700
     cagctcatct ccgcctatct tgccgaaccc cgcacctacg gcatcacttt gcgcgggagt      2760
     ttctga                                                                 2766
//

If you have problems or comments...

PBIL Back to PBIL home page