(data stored in ACNUC7421 zone)

EMBL: AP010803.PE149

AP010803.PE149       Location/Qualifiers
FT   CDS_pept        154790..155506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94983"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXA1"
FT                   /protein_id="BAI94983.1"
FT                   /translation="MNKLIADAIDAHGGWERWEALKSVQVDVVTGGELLDRKTAPGSGT
FT                   LRITAKTQRQECRMGPIDGDMITILEPGRVAIETADGTLVAERHDPRAAFNGHELDTPW
FT                   DPLHRTYFGCYAMWSYLTVPFSLAMPGVQVWDIDPLEEDGELWQGVRVVMPDEIATHSR
FT                   AQEFYFGDDMLIRRQDYTLDIAGGHRIANYALDIVSVDGLKFASKRRAYMCNKKYEVLR
FT                   DRLLIRLDLSNFQLIA"
     atgaacaagc tgatcgcgga tgccatcgac gcccatggag ggtgggagcg atgggaagcg        60
     ctcaaatcgg tgcaggtcga tgtggtgacc ggcggcgaat tgcttgaccg gaaaacggct       120
     cccggttccg gcacgctgcg gataacggcc aagacgcagc gccaggaatg ccgcatgggt       180
     ccgatcgacg gtgacatgat cacgattctg gaaccgggcc gggtagcgat tgaaactgcg       240
     gacgggacgt tggtcgcaga gcggcacgac ccgcgcgcgg ccttcaacgg tcatgaactg       300
     gatacgccct gggatccgct gcatcgcacc tatttcggct gctatgcgat gtggagctat       360
     ttgaccgtgc ccttctccct cgcgatgccg ggagtgcagg tgtgggacat tgatccgctt       420
     gaagaggatg gggagctctg gcagggcgtt cgtgtcgtca tgccggatga aatcgcgacc       480
     catagccggg cgcaggaatt ctatttcggc gacgatatgc tcatccggcg ccaagactat       540
     acgctcgaca tcgccggcgg ccatagaatt gcgaactatg ccctggatat tgtgagcgtg       600
     gatggcctaa agttcgcctc gaaacgccgg gcctatatgt gcaacaagaa atatgaggtt       660
     ctgcgcgatc ggctgctcat ccggctggac ctctccaact ttcagttgat cgcgtga          717
//

If you have problems or comments...

PBIL Back to PBIL home page