(data stored in ACNUC7421 zone)

EMBL: AP010803.PE150

AP010803.PE150       Location/Qualifiers
FT   CDS_pept        complement(155644..157224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-01500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94984"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXA2"
FT                   /protein_id="BAI94984.1"
FT                   /translation="MFFAGLIMSEWLSQPVTDFRGRPLAEPGTPAGYAALIERYGLRLP
FT                   LPARLAAIAERHHPRSTAEWQMMTPRHMPDATLIGHLTFAFRYEGIDLSILAQLFRAEE
FT                   PAAFARIVRDAPTGSFARRIWFLYEWMTGDRLDVPDAGKVRLVPVVDTRLQLALADGVA
FT                   SPRHRVANNLPGTPRYCPMVRRTDAILAYEAQAFDERARAVVGRIRADLVARAAAFLLL
FT                   NDSKSSFAIEGEKPSGTRAARWGQAIAEAGSRPLSLAEFDRLQRIVIGDQRFVRLGLRE
FT                   EGGFVGVHHRETGLPVPDHVSARESDLRDLVEGLVAYSARAVAGGMDPVAAAAVLAFGF
FT                   VYIHPYVDGNGRLHRWLFHHVLASARFNPPGMVFPISAVILRRIDAYKGTLTSYSGPLL
FT                   PFIEWEPTPEGNVRVLNDTADFYRFFDATAHVEFLYACVQQTIEEDLPREARFLEAFDS
FT                   FNEAVQQIVDMPTAQVELLLKFLEQNEGRLSQPARSREFEALTPAEVEQVEAVYADAFG
FT                   PEKVNPHKP"
     atgttcttcg cgggattgat catgagtgaa tggctttcgc aaccagtgac tgactttcgc        60
     gggcggccgc ttgccgagcc gggaacgccc gccggctacg cggcgctgat cgaacgctat       120
     ggccttcgcc tgccgctgcc cgcccgcctg gccgcgatcg ccgagcggca tcatcctcga       180
     tccaccgccg aatggcagat gatgacgccg cggcacatgc ccgacgcgac actgatcggc       240
     catctgacat tcgctttccg ctatgaaggt atcgatcttt ccattcttgc ccagcttttc       300
     cgggccgagg agccggctgc gttcgcccgg atcgtgcgcg atgcgccgac gggcagcttc       360
     gctcgcagga tctggtttct ctacgaatgg atgaccggcg accggctgga cgtgccggat       420
     gccggcaagg tgcgcctggt gccggtcgtc gatacaaggc tgcaactggc gctggcggac       480
     ggcgttgcgt cgccgcgcca tcgcgtcgcc aacaacctgc ccggcacgcc gcgatattgc       540
     ccgatggtgc gcaggaccga cgcgatcctc gcctatgagg cgcaggcatt cgacgagcgc       600
     gcccgcgccg tggtcgggcg cattcgcgcc gacctcgtcg cccgcgccgc cgccttcctg       660
     ctgctcaacg attcgaagtc ctccttcgcc atcgaagggg agaagccttc ggggacgaga       720
     gccgcccgct ggggacaggc gatcgccgaa gccggatcgc ggccgctgag cctggcggag       780
     ttcgaccggc tgcaacgcat cgtcatcggc gatcaacgct tcgtccggct gggccttcgc       840
     gaagagggtg ggttcgtcgg cgtccaccac cgggagacgg gattgcccgt gcccgaccat       900
     gtcagcgccc gcgaaagcga tctgcgcgat ctcgtggagg gtctggtcgc ctattcggcg       960
     cgagccgtcg ccggcggcat ggacccggtc gcggcggcgg ccgtgctcgc tttcggcttt      1020
     gtctacatcc acccctatgt cgacggaaac ggccgcctgc atcgctggct ctttcaccac      1080
     gtcctggcgt ccgcgcgctt caatccgccg ggcatggtgt tcccgatcag cgcggtgatc      1140
     ctgcgccgga tcgacgcgta caagggcacg ctcacctcct attcgggacc gctgcttccc      1200
     ttcatcgaat gggaaccgac gccggagggc aatgtgcggg tgctgaacga cacggccgac      1260
     ttctaccgat ttttcgacgc caccgcgcat gtcgaattcc tgtacgcctg cgtccagcag      1320
     accatcgagg aggacctgcc ccgcgaagct cgcttcctcg aagccttcga cagcttcaac      1380
     gaggcggtgc agcagatcgt cgacatgccc accgcccagg tcgaactgtt gctgaagttt      1440
     ctggagcaga atgagggacg cctgtcgcag cctgcccgat cgagggaatt cgaggcgctc      1500
     acccccgccg aagtcgaaca ggtggaggca gtctacgcag atgcgtttgg gcctgaaaaa      1560
     gtaaatcccc acaagcctta g                                                1581
//

If you have problems or comments...

PBIL Back to PBIL home page